KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_0353Help
Entry
CFF8240_0353      CDS       T00430                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
cff00260  Glycine, serine and threonine metabolism
cff00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cff01100  Metabolic pathways
cff01110  Biosynthesis of secondary metabolites
cff01130  Biosynthesis of antibiotics
cff01230  Biosynthesis of amino acids
Module
cff_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cff00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFF8240_0353 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CFF8240_0353 (trpB)
Enzymes [BR:cff01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CFF8240_0353 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABK81852
UniProt: A0RMX2
Position
323169..324350
Genome map
AA seq 393 aa AA seqDB search
MNVKAYFGKYGGQFVPETAMNALLELEEAYESIANTKEFRDELDSLLKDYVGRPSPLYHA
KRLSEYYGHEIYLKREDLNHTGAHKINNALAQALLAKKMGKRKVMAETGAGQHGVATATA
AALLGLECDVYMGECDTKRQALNVYKMHLLGANVVSITDGLATLKEATTAAIQAWVNEIE
ARFYVIGSAVGPHPYPKMVRDFQSVIGREAKAQLNEKGVKPDYIIACVGGGSNAIGIFSA
FLGDENVKIIGVEAAGLGADTPYHAATLTKGKDGIIHGMKTVVLQDEYGRILPVHSISAG
LDYPGVGPEHAHLKDIKRVEYYAVSDDECINALKLCTRLEGIIPAIESSHALAYLEKLCP
NLKTKSNIVINVSGRGDKDMNTIMEYKKGTIYG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaaaagcgtattttggaaaatatggtggtcagtttgttccggagactgctatg
aacgctcttttggagcttgaagaagcttatgagagcatagcaaataccaaagaatttaga
gatgagttagattctcttttaaaagattatgtcggcagaccaagtccgttgtatcatgca
aaaaggttaagcgagtattacggtcacgaaatttatctcaagcgcgaagatctaaatcat
actggagctcataagataaataatgctttagctcaagcattgctcgcaaaaaaaatggga
aaaagaaaggtgatggctgaaacaggagctggacagcacggagttgcgactgcgactgct
gctgcacttttaggtttagaatgcgacgtatatatgggagagtgtgacactaaaagacaa
gcgttaaacgtctataaaatgcatcttttaggagcaaacgtagtaagtataaccgatggt
ttggctactttaaaagaagctaccaccgcagctattcaagcatgggtaaatgagatagaa
gcaaggttctatgttataggctcagcggtcggacctcatccgtatccaaagatggttagg
gattttcaaagtgttatagggcgcgaagccaaagctcagctaaatgaaaaaggagtgaaa
ccagattacattatagcttgcgtaggcggcggaagtaatgctataggtatattttcagca
tttttgggtgatgaaaacgtgaagataataggcgtagaagccgcaggtttaggggctgat
actccttatcacgcggctactttgacaaaaggaaaagacggtataatccatggtatgaaa
acagtggttttacaagatgagtacggaagaattttgcctgttcatagtataagtgccgga
cttgattacccaggagtaggaccagaacacgctcatttaaaagatattaaaagagtagaa
tactacgcagtaagcgatgatgagtgtataaatgctcttaagctttgtacgcgcttagaa
ggtataatacctgctatagaaagctctcacgctttagcttatcttgaaaaactctgtccg
aatttaaaaacaaaatcaaatatagtcataaacgttagcggtagaggtgataaagatatg
aatactataatggagtataaaaaaggaacaatatatggataa

DBGET integrated database retrieval system