KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_0354Help
Entry
CFF8240_0354      CDS       T00430                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cff01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cff00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cff00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
324343..325092
Genome map
AA seq 249 aa AA seqDB search
MDKIQKAFEGKKANIGYIVAGYPNLEYTKEFLNLLDESCLDIIEIGIPYSDPLADGKLIS
MASFSACQSGVTTDTVFDMLKDVKTDKALVFLVYYNLILAYGEDKFLAKAKEVGISGLIV
PDMPHDESSEFRVKTSKFKLCLIPLISPTSSKRTKDILSDANGFIYAVGSLGVTGGEQSP
VDRLKDMIKDIKSSTSLPVAVGFGIKTNEDVKKTKLYADGAIVGTEIVKLTNKYSPNEIN
YHIEEIFKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggataagatacaaaaagcttttgagggcaaaaaagcaaatataggctatatagtcgcc
ggatacccaaatttagaatacacaaaagagtttttaaatttacttgatgagagctgtctt
gatattatagagatcggaattccgtattctgatcctttggctgatggaaaactcataagt
atggctagttttagtgcgtgtcaaagtggagttactacagacactgtttttgatatgctt
aaagatgttaaaacggataaagctttggtatttttagtctattataatctaattttagcc
tatggggaagataaatttttagctaaagcaaaagaggttggtataagcggattgatagtt
cctgatatgcctcatgacgaaagtagtgaatttagagttaaaacttctaaatttaagctt
tgtttaatacctcttatcagccctacgtcttctaaacgcacaaaagatatattaagtgat
gctaacggatttatctacgcagtcggctctcttggcgtaactggaggtgagcaaagtcca
gtagataggctaaaagatatgataaaagatataaaaagctctacttcattgcctgtagcc
gtcggttttggtatcaaaacaaatgaggatgtgaaaaaaacaaaattatatgccgacggt
gctatagtaggcactgagatagtcaaactcacaaataagtatagcccaaatgagataaat
tatcatatagaagagatattcaaaaaatag

DBGET integrated database retrieval system