KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_0440Help
Entry
CFF8240_0440      CDS       T00430                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:cff00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
419710..422304
Genome map
AA seq 864 aa AA seqDB search
MSSFLKTPFVLTAGICLSLSSVFGASELETIMKERNLSEKDILAAAKTYQPSGRKDEFIV
FSSGGQSGQVIVYGVPSMRIYKYIGVFTPEPWQGYGYDNESKAILKSGAIRGKEISWGDT
HHPNFTEKNGEYVGDYLFINDKANPRMAVISLHDFETTQIVVNPIMKSEHGGSFVTPNTE
YVIEASQYAAPLDNNYHPIEEYEAVYRGAVTFWKFDYPKGKIDEKKSFSLELPPYMQDLS
DAGKGESMGWGFTNSFNSEMYTGGIEKGLPPFEAGMSRNDTDYMHVYNWQALEKLVQDPK
NYTIINDHKVIPISVAVANNALFLIPEPKSPHGVDVTPDGRYIVVGGKLDTHASVYDFRK
IKNLIDKKDFAGKDPFGIPILDMKKALHGQVELGLGPLHNTFEEKDGIIYTSLYVDSQIV
KWDYKNLKVLDRVNVHYNIGHLDTMEGKSAKPIGKYALALDKLSIDRFNPVGPLHPQNHQ
LIDITGPKMELIYDMPIPLGEPHDVVSIAASKLKPAMTYKMGTNSRTGEQSVGMTLAGQE
RIERNGKNVTVYATMIRSHINPEHIELNKGDNVTIYLTNLERAQDETHGFAIDLYNVHAS
IEPGKTASVSFVADMEGVFPYYCTEFCSALHLEMMGYMYVKDPNKKYESVKKAKLKELTK
EQLEAEYKKVIATNKATDDVIQSVVTFLKEKHFEKYPKVKQLVEDALDQYGKIPEVKAKA
DAAYKAGDVNGAILWEYQVWQYMVKTADVGLRAKNNLTKALATPMSKVQARGEEAYLKGG
CNGCHVIGQVSSGPDLTGVLLRHDNAEQWVFDFIKNPASKYEEDYVKAMINYFNLRMPNQ
HMTDQEIKDIIEYLKWIDENAGLN
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgagtagttttttgaaaactccgtttgtacttacggctggcatctgtcttagcttgtca
tctgtttttggtgcaagtgagcttgaaactatcatgaaagagcgaaacttgagcgaaaaa
gatattctagcggcagctaaaacttatcagccaagtggtcgtaaagatgagttcatcgtt
ttttcatctggcggacaaagcggacaggttatagtttatggtgtcccatctatgaggatt
tacaaatatatcggcgtatttactccagagccttggcaaggatacggatatgacaatgaa
agcaaagctatactaaaaagcggagctatcagaggcaaagagataagctggggagatact
caccacccgaatttcactgagaaaaacggcgaatacgtgggcgattatctatttataaat
gataaagccaaccctagaatggctgttatcagcttgcacgactttgagacaactcaaatc
gtagtaaatcctatcatgaaaagtgagcacggcggtagctttgttactccaaataccgag
tatgttatcgaagctagccaatatgcagctccgcttgataataactatcacccgatagag
gaatatgaggcggtttatagaggtgctgttacattttggaaatttgattatccaaaaggt
aaaatagatgagaaaaaatcattctcacttgaacttcctccatacatgcaagacttaagc
gatgcaggtaaaggcgagtctatgggctggggcttcacaaacagctttaactcagagatg
tatacaggcggtatagaaaaaggtcttcctccgtttgaggctggtatgagtagaaatgat
actgactatatgcacgtttataactggcaagcattagaaaaacttgtacaagatccaaaa
aattatacaattataaatgatcataaagttattcctattagtgttgcagttgcaaacaat
gctctatttttaattcctgagccaaaatctccacacggtgtagatgtaactcctgatggt
agatatatagtagtcggcggtaagctagatactcacgctagtgtttatgacttcagaaaa
atcaaaaatttgattgacaaaaaagactttgcaggcaaagatccttttggtattcctatt
cttgatatgaaaaaggctcttcacggacaagtagaacttggtcttggaccacttcataat
acatttgaagaaaaagatggtatcatctatacatcattgtatgttgatagtcaaatcgta
aaatgggattataaaaatttaaaagttctagacagagtaaatgtacactataacataggt
caccttgacactatggaaggtaaatcagcaaaacctataggcaaatatgctttagcgctt
gataaactttcaatagacagatttaatccggttggtcctcttcatccacaaaatcaccaa
cttatcgatataacaggtcctaaaatggagctaatatacgatatgccgattccactaggt
gaacctcacgatgttgtatctatagcagctagcaaactaaaacctgctatgacatacaaa
atgggtacaaactcaagaaccggtgagcaatcagtcggtatgactctagctggacaagag
agaatagaaagaaacggtaaaaacgtaaccgtatatgctacaatgataagaagccatatc
aacccagagcatatagaattaaataaaggcgataacgttactatctatctaacaaactta
gagcgtgctcaagatgagactcacggatttgctatagatctttataacgtacatgcttct
atagaaccaggtaaaactgcaagcgttagctttgtagccgatatggaaggtgttttccct
tactattgtaccgagttctgttcagctcttcaccttgagatgatgggttatatgtatgta
aaagatccaaacaagaagtatgaatcagttaaaaaagcaaaacttaaagagcttacaaaa
gagcaattagaagctgaatataaaaaagttatagcaacaaataaagcaactgacgatgtt
atccaaagtgttgttacattcttaaaagaaaaacacttcgagaaatatccaaaagttaaa
caacttgttgaagatgcacttgatcaatacggaaaaatacctgaagttaaagccaaagct
gatgctgcttataaagcaggtgatgtaaatggcgctatcctttgggaataccaagtatgg
caatacatggtaaaaacagccgatgttggtttaagggctaaaaacaaccttacaaaagct
cttgcaactcctatgagtaaagttcaagctcgcggtgaagaagcatacttaaaaggcgga
tgtaacggttgtcacgttatcggtcaagtaagttcaggcccggatctaacaggcgtttta
ctaagacatgataatgctgagcaatgggtatttgatttcatcaaaaatccagctagcaaa
tacgaagaagactatgtaaaagctatgattaattactttaatctaagaatgccaaatcaa
catatgaccgatcaagagatcaaagatatcatcgagtacctaaaatggatcgatgagaat
gcaggacttaattag

DBGET integrated database retrieval system