KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_0568Help
Entry
CFF8240_0568      CDS       T00430                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cff00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CFF8240_0568
Enzymes [BR:cff01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CFF8240_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
575174..575767
Genome map
AA seq 197 aa AA seqDB search
MNIEYSMGEIKKISASMFKKNFFGIFHGSISARIEHNQFVINKKDAIFDGLSNDDLTLLY
SKKDYRWNDASIDSDIHLNIYKNIGEAKYICYAMPPYLTAYSMDHITIEPRDYFGYMKFD
NIFIYDIKQFDDWYERAPSEICRYMIEKNSNIMVIKGYGVYVYERTAYDLAKTVALLENS
CKMINYASRFQNLNLGL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaatactctatgggtgagataaaaaagatatccgcatctatgtttaaaaag
aattttttcggtatattccatggatctatatcggctagaatagagcataatcagtttgtt
atcaataaaaaagatgcgatatttgatggacttagcaacgatgatctgactttgctttat
tccaaaaaagattatagatggaacgatgctagcatagatagcgatatacatctaaatata
tataaaaatatcggcgaggcaaaatatatttgttacgcgatgccgccttatttgacagct
tacagcatggatcatataactattgaaccgcgagattactttggatatatgaaatttgat
aatatatttatttatgatataaagcaatttgatgattggtatgagagagctccatctgag
atatgtaggtatatgatagaaaaaaacagcaatatcatggttataaaaggatatggtgtt
tatgtatatgaaagaactgcgtatgatctggcaaagacggtagctcttttagaaaatagt
tgtaaaatgataaattatgcaagcagatttcaaaatttaaatttaggtttgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system