KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_0627Help
Entry
CFF8240_0627      CDS       T00430                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
cff00300  Lysine biosynthesis
cff01100  Metabolic pathways
cff01120  Microbial metabolism in diverse environments
cff01230  Biosynthesis of amino acids
Module
cff_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cff00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CFF8240_0627 (dapE)
Enzymes [BR:cff01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CFF8240_0627 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABK82094
UniProt: A0RNM0
Position
636725..637822
Genome map
AA seq 365 aa AA seqDB search
MEVVEILKELLKFKSITPDDDGAMNFINMFMDGFDADFVDVNGIKNLILTKKFGDGVHLC
FAGHIDVVPAGDGWDSDPFEPELKDGFVYARGAQDMKSGVAAFLCACKDATKFNGTLSII
LTSDEEGDGIYGTLEALKFLKSRGNLPDFALVAEPTSSSTFGDTIKIGRRGSVNGVVTIN
GVQGHAAYPEKCVNPVHQLASVFSDFAGYELDSGSKYFGASKIVITDIRGGMEVVNVTPK
SVKIMFNVRNSELTSCEDIKRYTEHIFNGFDFTLSLKESSKPFLTDESSKIVIQAQKSIE
NICKISPDLSTSGGTSDARYFAAFGVPVVEFGVVNDRIHAINERVLQSEVESLYLVFKDL
IENFE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggaagttgtagaaattttaaaagagcttttgaaatttaaaagcattactccagatgat
gatggtgctatgaattttataaatatgtttatggatggatttgatgctgatttcgttgat
gtaaatggcataaaaaatcttattttgacaaagaaattcggagatggcgttcatctatgt
ttcgcaggtcatatagacgtagtgcctgccggagacggctgggatagtgatccttttgaa
cctgaattaaaagatggttttgtttatgcaagaggcgcccaagatatgaaaagcggagta
gcggcttttttatgcgcatgtaaagacgctactaaatttaacggaactcttagtataatc
cttactagtgatgaagagggagacggtatttatggcactctagaagcccttaaattttta
aaaagcagaggaaatttaccggactttgctttagttgccgagccgacatcttcaagtaca
tttggcgatactataaaaatcggtcgaagaggctcggtaaacggggtcgtaacaataaac
ggagttcaaggtcacgcggcttatcctgaaaaatgcgtaaatcctgtacatcaattagct
agcgttttttctgattttgcaggatatgaacttgatagcggcagtaagtattttggtgct
agcaagattgttattactgatattagaggaggtatggaggttgtaaatgttacgccaaaa
agcgtaaaaattatgtttaatgtaagaaactctgaattaactagttgtgaagatataaaa
agatatactgagcatatttttaatggatttgattttactttaagtctaaaagagagttca
aaaccgtttttaacagatgaaagttcaaagatagtcattcaggctcaaaaaagcattgaa
aatatctgcaaaatttcacctgatcttagtactagcggcggtactagcgatgctagatat
tttgcggcttttggagttcctgttgtagagtttggagtagtgaatgatagaattcacgcc
ataaacgagagagttttacaaagcgaggtggagtctttatatcttgtatttaaagattta
attgagaattttgagtaa

DBGET integrated database retrieval system