KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_0627Help
Entry
CFF8240_0627      CDS       T00430                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cff00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CFF8240_0627 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    CFF8240_0627 (dapE)
Enzymes [BR:cff01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CFF8240_0627 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
636725..637822
Genome map
AA seq 365 aa AA seqDB search
MEVVEILKELLKFKSITPDDDGAMNFINMFMDGFDADFVDVNGIKNLILTKKFGDGVHLC
FAGHIDVVPAGDGWDSDPFEPELKDGFVYARGAQDMKSGVAAFLCACKDATKFNGTLSII
LTSDEEGDGIYGTLEALKFLKSRGNLPDFALVAEPTSSSTFGDTIKIGRRGSVNGVVTIN
GVQGHAAYPEKCVNPVHQLASVFSDFAGYELDSGSKYFGASKIVITDIRGGMEVVNVTPK
SVKIMFNVRNSELTSCEDIKRYTEHIFNGFDFTLSLKESSKPFLTDESSKIVIQAQKSIE
NICKISPDLSTSGGTSDARYFAAFGVPVVEFGVVNDRIHAINERVLQSEVESLYLVFKDL
IENFE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggaagttgtagaaattttaaaagagcttttgaaatttaaaagcattactccagatgat
gatggtgctatgaattttataaatatgtttatggatggatttgatgctgatttcgttgat
gtaaatggcataaaaaatcttattttgacaaagaaattcggagatggcgttcatctatgt
ttcgcaggtcatatagacgtagtgcctgccggagacggctgggatagtgatccttttgaa
cctgaattaaaagatggttttgtttatgcaagaggcgcccaagatatgaaaagcggagta
gcggcttttttatgcgcatgtaaagacgctactaaatttaacggaactcttagtataatc
cttactagtgatgaagagggagacggtatttatggcactctagaagcccttaaattttta
aaaagcagaggaaatttaccggactttgctttagttgccgagccgacatcttcaagtaca
tttggcgatactataaaaatcggtcgaagaggctcggtaaacggggtcgtaacaataaac
ggagttcaaggtcacgcggcttatcctgaaaaatgcgtaaatcctgtacatcaattagct
agcgttttttctgattttgcaggatatgaacttgatagcggcagtaagtattttggtgct
agcaagattgttattactgatattagaggaggtatggaggttgtaaatgttacgccaaaa
agcgtaaaaattatgtttaatgtaagaaactctgaattaactagttgtgaagatataaaa
agatatactgagcatatttttaatggatttgattttactttaagtctaaaagagagttca
aaaccgtttttaacagatgaaagttcaaagatagtcattcaggctcaaaaaagcattgaa
aatatctgcaaaatttcacctgatcttagtactagcggcggtactagcgatgctagatat
tttgcggcttttggagttcctgttgtagagtttggagtagtgaatgatagaattcacgcc
ataaacgagagagttttacaaagcgaggtggagtctttatatcttgtatttaaagattta
attgagaattttgagtaa

DBGET integrated database retrieval system