KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_0777Help
Entry
CFF8240_0777      CDS       T00430                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cff00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cff00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
787697..788761
Genome map
AA seq 354 aa AA seqDB search
MKKLIIFFASVYLLFGASNDEAELKKMIGQMIMIGFSHSSANDSWTDQLVLDAGFGRIGG
VMLLARNISTKDELIKLTKKLSSSKSKHKLLIAIDEEGGKVSRFINKDGFKHFPSAYEVG
SKMNLNKAGIIYKDMADQLKNLGINMNFAPVVDVYNPNSSIIGQKNRAFSKNPDEVIAYS
SEFIKSFDKANIKTVLKHFPGHGNAIKDTHKEKTVVDNYDFDELKPYFELIKRGQASFIM
VAHVYIPNLDDKNPAVLSKHIVSDILKNRFKFKGAVMSDDLLMKGLGELSIEQKVVRAIN
AGVDIVLVSEYFLNNSNSIKIINDAILNAVNSGKISKERIKDAYTRILRSKEGL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaattatattttttgctagcgtttatttgttgtttggtgcttcaaatgat
gaagcagagcttaaaaagatgataggtcaaatgattatgataggatttagtcactcaagc
gcaaatgatagttggactgatcaacttgtacttgatgcaggttttggtcgtataggcgga
gttatgcttcttgctagaaatatcagcacaaaagacgagcttatcaaacttacgaaaaaa
ttatcttcatcaaaatcaaaacacaagcttctcattgctatcgacgaggagggcggaaaa
gtcagtagatttataaataaagacggctttaagcattttccatcggcctacgaagtcggt
agcaagatgaatttaaataaagccggtatcatatacaaagatatggcagatcagttaaaa
aaccttggaatcaatatgaactttgctcccgtcgtcgatgtttataatccaaactcatct
ataataggacaaaaaaatagagcattcagtaaaaatcctgatgaagttatagcatatagt
agcgagtttataaaatcatttgacaaggcaaacataaaaactgtgctaaaacattttcct
ggccatggaaatgctatcaaagatactcataaagaaaaaacagttgtggataactacgat
tttgatgaattaaagccgtattttgagttgataaaacgaggtcaagcaagtttcatcatg
gtagctcacgtgtatataccaaatttagatgataaaaatccggcggttttgtcaaaacat
atagtaagcgatatcttgaaaaatcgttttaaatttaaaggtgcagttatgagcgacgat
cttcttatgaaaggtcttggcgagcttagcatagaacaaaaagtcgtaagagcgataaac
gccggagtggatatagttttggttagtgagtattttttaaataactcaaactctataaaa
ataataaatgacgcgatattaaatgcggtaaatagcggcaagataagcaaagagcgtata
aaggacgcctatacaaggatacttagatcaaaagaaggtttatga

DBGET integrated database retrieval system