KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_1082Help
Entry
CFF8240_1082      CDS       T00430                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
cff00260  Glycine, serine and threonine metabolism
cff00750  Vitamin B6 metabolism
cff01100  Metabolic pathways
cff01110  Biosynthesis of secondary metabolites
cff01120  Microbial metabolism in diverse environments
cff01230  Biosynthesis of amino acids
Module
cff_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cff00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFF8240_1082
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CFF8240_1082
Enzymes [BR:cff01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CFF8240_1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CutA1 PALP Thr_synth_N ProRS-C_1
Motif
Other DBs
NCBI-ProteinID: ABK82229
UniProt: A0RPW0
Position
1079862..1081604
Genome map
AA seq 580 aa AA seqDB search
MIVLSTTPDEKIANKLAKELVDKKAAACVNCIKDLKSFYTWKNEVQNDSEVLMMIKGNYK
KIKDVILKNHPYETPEVIAIKPKKIEKSYKKWLEKSTKISPMLVGTRLNNNEEVSCVSLS
EALLQPAAKHGGLYAPINLPILDDNFFKKASKLKYDEIAMMVIKKFKFDIDKDIFKKALK
RYAKFDKEAVEIKKLNKNLYINELWHGPTRAFKDMALQPFGVILKELAKQNNKKYLIMCA
TSGDTGPATLNTFSDVQNIKVVCIYPKDGTSEVQRLQMVNQKGKNLKSIGIKGNFDDAQK
ALKALLNDKSFKNELSNLGLNLSAANSVNFGRILFQIIYHIYVCIKINSNKKPIDIVVPS
GNFGNTLGAYYAKKMGANIGKIKIASNANNILTELFTTGIYNLQDKKLIQTISPAMDILI
SSNVERLLFDKFGSIRTKELMDSLKNSGFYKLAQEELEELKADFEADFCSDEECENYIKN
VSSKGILIDPHTATCLKLVDNDKLSVITSTAQWVKFTPSMVKAIKNKPTQDELVDMKELA
KEFDVKIPKSILELFSQKELHKDVIEQDKIKSNIINWLKK
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgatagtattaagtacaacaccagatgaaaaaatagcaaataagttggctaaagagtta
gtagataaaaaagctgcggcttgtgtgaattgtataaaagatctgaaaagcttttatact
tggaaaaatgaagtacaaaacgactctgaagttcttatgatgataaaaggaaattataag
aaaataaaagatgttattttaaaaaatcacccttatgaaacaccggaagtcatagctata
aaacctaaaaaaatagaaaaaagctataaaaaatggttagaaaaaagtacaaaaatatca
cctatgttagtaggtacaaggttaaataacaacgaagaagtttcttgcgttagtttaagc
gaagctttattgcaaccagcagcaaaacatggcggactttacgcgcctataaatttacct
attttggatgataacttttttaaaaaagcatctaaattaaagtatgatgagatagctatg
atggttattaaaaagtttaaatttgatatagacaaagatatttttaaaaaagcattaaaa
agatacgctaaatttgataaagaagcagtggaaataaaaaaattaaataaaaatttatat
ataaatgagttatggcacggacctacaagagcatttaaagatatggcgcttcagcctttt
ggtgtaattttaaaagagcttgccaaacaaaataataaaaaatatctcattatgtgtgca
acaagcggcgataccggacctgccacactgaatacatttagcgatgttcaaaatataaaa
gtcgtatgcatatatccaaaagacggcacaagcgaagttcaacgcttacaaatggtaaat
caaaaaggtaaaaatttgaaatccatagggataaaaggtaattttgatgatgctcaaaaa
gccttaaaagcgctattaaacgataaatcttttaaaaatgagctatcaaatttggggctt
aacttaagtgctgcgaattctgttaatttcggcagaattttatttcagattatttatcat
atctatgtttgtataaaaataaacagtaataaaaaaccgatagatatcgttgttccaagc
ggcaacttcggtaatactttaggggcgtattacgctaaaaaaatgggtgcaaatatagga
aaaataaaaattgcttcgaacgcgaacaatatattaacggaacttttcacaacaggaatt
tataatctgcaagataaaaaattaattcaaactataagccctgctatggatatactaatt
agctcaaatgtcgaaagacttttgtttgataagtttggaagtattagaacaaaagagctt
atggatagtttgaaaaacagtggattttataaactcgctcaagaagaacttgaggagcta
aaagcagattttgaagcagatttttgtagcgatgaagagtgtgaaaattatataaaaaac
gtttcaagcaaaggtattttgatagatcctcatacggcaacttgcctaaaactagttgac
aatgataaacttagcgtgataacatctacagctcaatgggtaaaatttactccaagcatg
gtaaaagctatcaaaaataaacctacacaagatgaattagtagatatgaaagagcttgca
aaagagtttgacgtaaaaattccaaagtccatcttagagttattttcacaaaaagagctt
cataaagacgttatagaacaagataagataaaatcaaacatcataaattggcttaaaaaa
tga

DBGET integrated database retrieval system