KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_1137Help
Entry
CFF8240_1137      CDS       T00430                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cff00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CFF8240_1137 (recR)
DNA repair and recombination proteins [BR:cff03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CFF8240_1137 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1129073..1129642
Genome map
AA seq 189 aa AA seqDB search
MPNQKLEKFNELVSCFEKIPGVGKKSALKYAYHVALQDSFFGLNLAHTIEDAVRFLKHCS
MCGGISENEICDICSDINRDKKTLCIVETPKDILTIEYSNSFNGLYFVFDDANKLDKLKS
NIKENGIKELLFALTPSINSDGMMLYIEDKLKDFDVSFTKIAQGIPTGVSLENVDILSLT
KAIKDRRSL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatcaaaagcttgaaaaatttaacgagcttgtgtcttgttttgaaaaaataccg
ggagtaggtaaaaaatcagcactaaaatatgcgtatcacgtagccctacaagactcgttt
tttggtttaaatttagcacataccatagaagatgctgtaagatttctaaaacactgctca
atgtgcggtggaataagcgaaaatgagatctgtgatatatgtagcgatataaatagagat
aaaaaaaccctttgtatagtagaaacgccaaaagatatattaaccatagagtattcaaac
tcatttaacggtttgtactttgttttcgatgatgcaaataaacttgataaattgaaatcc
aatatcaaagaaaatggaatcaaagagctactttttgctttaactcctagtataaatagc
gatggtatgatgctatatatagaagataaattaaaagattttgacgtaagttttacaaaa
atagcacaaggcatacctactggagttagtcttgaaaatgtagatattttatctctgact
aaagcgataaaagatagaagatctttataa

DBGET integrated database retrieval system