KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_1427Help
Entry
CFF8240_1427      CDS       T00430                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:cff01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cff01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cff00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cff00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1412723..1413391)
Genome map
AA seq 222 aa AA seqDB search
MIYAANLKCNHTRGGFLEYAKELDNNMSGENVIVFPPSSAFLEAKFKFVQGAQNFYPCDN
GSFTGEIGAAMFDEFGITTVLIGHSERRTLGEDEPFLKAKFDFAKQKGWDVIYCIGEDDI
THMNGSTKEFLTEQLENIDLEYENLVIAYEPIWAIGTGKSANSVVITDILDFISTKTTAP
LLYGGSVNEKNICDIKAIKNCNGVLVGTASWDVKNFINLIKA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatatacgcggcaaatttaaaatgtaatcacacaagaggcggttttttggagtatgca
aaagagcttgataataatatgagcggtgaaaatgtgatagtttttccgccttcaagcgca
tttttagaagctaagtttaaatttgttcaaggcgcgcagaacttctatccgtgcgataac
ggctcatttaccggagagatcggtgcagcgatgtttgatgagtttggtatcactactgtt
ttaataggacatagtgagagaagaactttgggcgaagacgagccgtttttaaaggctaaa
tttgattttgcgaagcaaaaaggatgggatgttatctactgcataggcgaagatgatata
actcatatgaacgggagtacaaaagagtttttaacagagcagcttgaaaatatcgactta
gaatacgaaaatttagttatagcttatgagcctatttgggctatcggcactggaaaaagt
gctaattctgttgttataacagatattttggattttatatctacaaaaacaactgcgccg
ctgctttatggtggaagcgtaaatgagaaaaacatatgcgatataaaagctataaaaaac
tgtaacggagttttggtaggaactgcaagctgggacgtaaaaaactttataaatttgata
aaagcttaa

DBGET integrated database retrieval system