KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_1427Help
Entry
CFF8240_1427      CDS       T00430                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cff00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CFF8240_1427 (tpiA)
   01230 Biosynthesis of amino acids
    CFF8240_1427 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFF8240_1427 (tpiA)
   00051 Fructose and mannose metabolism
    CFF8240_1427 (tpiA)
   00562 Inositol phosphate metabolism
    CFF8240_1427 (tpiA)
Enzymes [BR:cff01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CFF8240_1427 (tpiA)
Exosome [BR:cff04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CFF8240_1427 (tpiA)
  Exosomal proteins of bladder cancer cells
   CFF8240_1427 (tpiA)
  Exosomal proteins of melanoma cells
   CFF8240_1427 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1412723..1413391)
Genome map
AA seq 222 aa AA seqDB search
MIYAANLKCNHTRGGFLEYAKELDNNMSGENVIVFPPSSAFLEAKFKFVQGAQNFYPCDN
GSFTGEIGAAMFDEFGITTVLIGHSERRTLGEDEPFLKAKFDFAKQKGWDVIYCIGEDDI
THMNGSTKEFLTEQLENIDLEYENLVIAYEPIWAIGTGKSANSVVITDILDFISTKTTAP
LLYGGSVNEKNICDIKAIKNCNGVLVGTASWDVKNFINLIKA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatatacgcggcaaatttaaaatgtaatcacacaagaggcggttttttggagtatgca
aaagagcttgataataatatgagcggtgaaaatgtgatagtttttccgccttcaagcgca
tttttagaagctaagtttaaatttgttcaaggcgcgcagaacttctatccgtgcgataac
ggctcatttaccggagagatcggtgcagcgatgtttgatgagtttggtatcactactgtt
ttaataggacatagtgagagaagaactttgggcgaagacgagccgtttttaaaggctaaa
tttgattttgcgaagcaaaaaggatgggatgttatctactgcataggcgaagatgatata
actcatatgaacgggagtacaaaagagtttttaacagagcagcttgaaaatatcgactta
gaatacgaaaatttagttatagcttatgagcctatttgggctatcggcactggaaaaagt
gctaattctgttgttataacagatattttggattttatatctacaaaaacaactgcgccg
ctgctttatggtggaagcgtaaatgagaaaaacatatgcgatataaaagctataaaaaac
tgtaacggagttttggtaggaactgcaagctgggacgtaaaaaactttataaatttgata
aaagcttaa

DBGET integrated database retrieval system