KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_1436Help
Entry
CFF8240_1436      CDS       T00430                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
cff00230  Purine metabolism
cff01100  Metabolic pathways
Module
cff_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cff00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CFF8240_1436
Enzymes [BR:cff01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CFF8240_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 ABC_tran Rad17 AAA_22 AAA_33 MMR_HSR1 AAA_17 AAA_29 CbiA RsgA_GTPase NTPase_1 AAA_14 NB-ARC NACHT RNA_helicase T2SSE cobW Cytidylate_kin ATPase_2 KTI12 Viral_helicase1 AAA_28 SRPRB MobB PRK AAA_24 DUF2075 AAA_30 AAA_25 KELK MBF2 AAA AAA_5 AAA_23
Motif
Other DBs
NCBI-ProteinID: ABK82935
UniProt: A0RQU2
Position
complement(1420475..1421086)
Genome map
AA seq 203 aa AA seqDB search
MSGQILIISGPSGSGKSTLLSKLMRDFDNIYFSISSTTRSIRDGEKDGVNYHYISEDEFK
TGIETAKFLEWAYVHKNYYGTSLEPVEKALKDGKIVIFDIDVQGFHLAMKKYREIITSVF
VTTKDRNELKRRLEIRDADLKDAIENRLFNAATEMGHINEYDYLIINDDLDRSYSSLKSI
FETMSVKTKNYDINAVIDSWNVC
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggacaaattttgataataagcggacctagtggaagtggcaaaagtacgctgcta
agtaagcttatgcgagattttgataatatatatttctcgatctcaagcaccacaagatct
ataagagatggcgaaaaagatggagtgaattatcattatataagtgaagatgagtttaaa
accggtatagaaacagctaaatttttagaatgggcttatgtgcataaaaattactatgga
actagccttgaaccggttgaaaaagctttaaaagatggaaaaatagtaatttttgatatc
gatgttcaaggatttcatttggctatgaaaaagtatcgcgagatcataacatcggttttt
gtaactacaaaagatagaaatgagctaaaaagacgtcttgagatcagagatgctgattta
aaagatgctatagaaaatagactatttaatgctgcaaccgagatgggacacataaacgag
tatgattatctgattatcaatgatgatcttgataggtcatattctagtttaaaatctatc
tttgaaactatgagcgtaaaaacaaaaaattatgatataaacgccgtgatagacagctgg
aacgtttgctaa

DBGET integrated database retrieval system