KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_1475Help
Entry
CFF8240_1475      CDS       T00430                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cff00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CFF8240_1475 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFF8240_1475 (pyrB)
Enzymes [BR:cff01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CFF8240_1475 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1455119..1456051
Genome map
AA seq 310 aa AA seqDB search
MSYVKKDLISTKDLSKDDIFSILSLAKDYKALNLEPVKKDPILKGVTVVNAFFENSTRTR
TSFEIAAKRLGADAINFSSSTSSTNKGETLIDTIHNIEAMKTDIFIVRHYSSGAAKFVTK
NTPSCVVNAGDGCNEHPTQALLDLLTIYEAKGSFSGLSVTIIGDIFHSRVARSNIYAMQT
LGIKVKLFGPPMFMQNAEVFGCHICKDMDEAVMGSDAIIMLRIQLERSDGEVAFPSIREY
SKYFGLTKTRMQKAKDDVIILHPGPINRGVEINSDVADDARFSSILDQVENGVAIRMAVL
KTIYQNKFKA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacgtaaaaaaagatctgatctccacaaaagacctatccaaagatgatattttt
tccattttaagtttagccaaagattacaaagctctaaatttagaacctgtaaaaaaagac
cctattttaaaaggcgtcacggtcgtaaatgcgttttttgaaaactcgactcgcacaaga
actagttttgaaatagcggcaaaaagattaggagccgacgcgataaactttagttcaagc
acttctagcacgaacaaaggtgaaactctcatcgacacaatacacaacatagaagctatg
aaaacagatattttcatagttcgccactatagttcaggagcggctaaatttgtaacaaaa
aatactccatcgtgcgtggtaaatgcgggggatggctgcaatgaacatccgactcaagca
cttcttgatcttcttacgatatacgaggcaaaaggtagtttttcaggtcttagcgtcact
ataataggcgatatatttcactcaagagttgctagatcaaacatatacgctatgcaaacc
ttaggtataaaagtaaaactttttggacctcctatgtttatgcaaaacgctgaagttttc
ggctgtcatatatgcaaagatatggacgaagcggttatgggaagcgacgctatcatcatg
cttagaattcagctcgaaaggagtgatggcgaagtagcgtttccaagcattagagagtac
agtaagtatttcggacttactaaaactcgtatgcaaaaagctaaagacgatgtcataatt
ttacacccgggacctataaacagaggcgttgagataaactcggacgtggctgacgacgct
agattttcaagcatacttgaccaagtagaaaacggcgtagctataagaatggcggtttta
aaaaccatttatcaaaataaatttaaggcttaa

DBGET integrated database retrieval system