KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_1535Help
Entry
CFF8240_1535      CDS       T00430                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
cff00330  Arginine and proline metabolism
cff00332  Carbapenem biosynthesis
cff01100  Metabolic pathways
cff01130  Biosynthesis of antibiotics
cff01230  Biosynthesis of amino acids
Module
cff_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cff00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CFF8240_1535 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CFF8240_1535 (proB)
Enzymes [BR:cff01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CFF8240_1535 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ABK82899
UniProt: A0RR36
Position
complement(1509339..1510103)
Genome map
AA seq 254 aa AA seqDB search
MKRVVIKVGSHVISDEHSISEKRVASLCEFLYDLSLKYEVILVSSGAISTGQTKLDIPRT
TVVNKQILSAIGQPYLMEIYSRALAKFGKQAAQLLLSAGDFDSRKKTNHALNVINGLLKN
GIIPIVNENDAIAISEIVYGDNDRLSSAVSFYFNADLLVILSDIDGYYDSDPRENKNAKI
RHLVTNLSDEELNRTSDTGSKHGTGGITTKLLAAKFLMDNKKDMFLASGFDLSDARAFLL
DNNQIGGTIFKGEQ
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagtggttataaaagtaggctctcacgtgatcagcgacgagcatagtataagc
gaaaaaagagtagctagtttatgcgaatttttatatgatttaagcttaaaatatgaagtg
attttggtaagttctggtgctataagtacgggtcaaacaaagcttgatatcccaagaact
actgttgttaataagcaaattctctctgctataggacaaccgtatttaatggaaatttat
agtagggctttggctaaatttggtaaacaagctgctcagcttttacttagtgctggcgac
tttgactcgagaaaaaagacaaatcacgcactaaatgttataaatggtcttttgaaaaac
ggtatcatacctatcgtaaatgaaaatgatgctatcgctatcagcgagatagtttatggt
gataacgatagactttcaagtgccgtttcgttttattttaacgccgatttgctagttata
ttaagcgatatcgatggttattacgatagcgatccaagagaaaataaaaacgcaaaaatc
cgtcatctagtcactaatttaagcgatgaagagctaaatagaactagcgatactggaagc
aagcatggtacaggcggcattacaacaaagcttttggccgctaagtttttgatggacaat
aaaaaagatatgtttttagctagcggatttgatcttagtgatgcaagagcatttttacta
gacaataatcaaataggcggtacgatattcaaaggcgaacaatga

DBGET integrated database retrieval system