KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_1548Help
Entry
CFF8240_1548      CDS       T00430                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Brite
Enzymes [BR:cff01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CFF8240_1548
Secretion system [BR:cff02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   CFF8240_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1523126..1523866
Genome map
AA seq 246 aa AA seqDB search
MKNVLIISSLIAATSMFAINDAEILDLFKAASNEGLQVKIESKSKLEGTNFDQIIVNITD
GKQSQKQVLFTDGKYVFPDIIDVNKRVSYLGKFNDIQEKASMGEAYSKLAALIKNLDKSK
IINLGNDPKKPTKYLFTDPDCPYCRIELDRIEKDLEESNLKVIMAPIPSHGEDAIKKSIA
IYKEVKGVKDDATKIKILRKYYAKDASAPTNITADQVKTEQANIMKYFETGAIRGVPAMI
DESDLK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttttaattataagttctctaatagcggctacttccatgtttgctataaac
gatgcggagattttagatctctttaaagctgcttcaaatgagggtttgcaagtaaaaata
gagtcaaaatcaaagcttgaaggtacaaatttcgaccaaattatagtaaatatcacagat
ggaaaacagagccaaaaacaagttttatttacagatggcaaatatgtatttccagatatc
atagacgtaaataaaagagtatcttatctaggtaaatttaacgatatacaagaaaaagcc
tctatgggcgaagcttatagcaaattagcagcacttataaaaaatcttgataaatcaaaa
attatcaatctaggaaatgaccctaaaaaacctacaaaatacttatttaccgatccggac
tgtccatattgcagaatcgaacttgacagaattgaaaaagatttagaagaatcaaattta
aaagttatcatggctccaattcctagccacggcgaagatgcgataaaaaaatcaatcgcg
atatataaagaggtaaaaggcgtaaaagacgatgccacaaagataaaaattctaagaaaa
tactatgccaaagacgcatccgctccaactaatataactgccgatcaagtaaaaacagaa
caagcaaatataatgaaatactttgaaacaggtgctataagaggcgtacctgcaatgatc
gacgagagcgatctaaaataa

DBGET integrated database retrieval system