KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_1611Help
Entry
CFF8240_1611      CDS       T00430                                 

Gene name
asnB
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cff00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1575654..1577456
Genome map
AA seq 600 aa AA seqDB search
MCRIAGGFATDLKDKIKQIAYALRNGGENEARFYFDQNFALSHNRLAIIDLSHNADQPVQ
NERFVLCFNGEIYNYKEIARDLELDDKFKNSDTLVLLAAYSKWGKSCLDKLDGMFAFCIY
DKFEKSIFLARDRLGVKPLYYYFKDDKFIFASELKAFFAYDNFDKSIDQTAFSHYLNSGY
MPGEQSIFKFIKKLPPAHFLEFSNVKKELKITKYYDLRSKFNTKKSVDLTKFENELENSI
ISRTISNVEFSSFLSGGLDSSVTATVLAKNGFKFKTISIGFESDKFNESDYAAAVAKNLG
LEHINYTLTPKIAKDIILQLPSVYDEPFGDSSAIPTLFLCQKARSLSKVALSSDGGDEIN
FGYARYDLNYQRYKFYKKFSFLKHIFLNLPYPLLKKAFELNSKTLGVDRYYRIKDSFKTN
KFMELYALEFRHFKNDEAKLLGISNEPNLSEFELENEYESMSFSDISTYLSDDIFVKTDR
AAMSVSLEVREPLLSYKFVDFMIKADPNLRKNKALFKAYLLKHLPKELVMRPKMGFALPI
EEWFHTDLGYLLDEYLTNQDFFDKQYILNLVQDFRDKKRVNFAKIWHILLFLMWKKRWNI
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagaatagcgggcggttttgctacagatctaaaagacaagatcaaacaaattgcc
tatgccttaagaaatggcggtgaaaatgaagctaggttttattttgatcaaaattttgca
ctttctcataatagattagccataatagaccttagccataatgcagatcaaccggtgcaa
aatgagcgtttcgtactctgttttaacggagaaatttacaactacaaagagatcgcgcga
gatcttgaattagatgataaatttaaaaacagcgacacattggttttgctagcagcatat
agcaaatggggtaaaagttgcttagataaacttgatggaatgtttgcattttgtatttat
gacaaatttgaaaaaagcatatttctagctagagacagactaggcgtgaaacctctttat
tactattttaaagatgataaatttatatttgcaagtgagttaaaagcattttttgcttac
gataactttgataaaagtatagatcaaacagctttctcacactatctaaactcaggatat
atgccaggcgaacaaagtatttttaaatttataaaaaagctgccccctgcacatttctta
gagttttccaacgtaaaaaaagagttaaaaatcacaaaatactacgacttgcgatctaaa
ttcaatactaaaaaaagtgtcgatttaactaaatttgaaaatgagctagaaaacagcatc
atatcacgaacaataagcaacgtcgagtttagctcatttttaagcggtggtcttgatagt
agtgttacggctacggtgttggctaaaaacggatttaagtttaaaactatttcaatagga
tttgaatccgataaattcaatgagagcgattatgctgccgcagttgcaaaaaacttaggt
ttggagcacataaattacactcttactccaaaaatcgccaaagatataattttacaacta
ccaagcgtatatgatgagccttttggagatagttcggcgatacctactctatttttatgc
caaaaagcaaggagtttatcaaaggttgcgctatctagcgatggcggagatgagataaac
tttggctatgcaaggtatgatttaaattatcaacgatataaattttataaaaaattctcg
tttttaaaacatatatttttaaatttgccctaccctcttttaaaaaaagcatttgagtta
aattcaaaaacattaggtgtagacagatattaccgtattaaagatagttttaaaaccaat
aaattcatggaattatatgctcttgaatttagacattttaaaaatgacgaagcaaaactt
ttaggaatttcaaatgaacccaacctaagtgagtttgaactagaaaatgaatatgaaagt
atgagttttagtgatatttcaacatatttaagtgatgatatttttgttaaaaccgatcgc
gcggcaatgagcgtgagcttagaagtgagagagccgcttttgagctataaatttgtggat
tttatgataaaagcagatcctaatttacgtaaaaataaagctttatttaaagcatatctt
ttaaaacatcttccaaaagagcttgtaatgagaccaaaaatgggatttgctcttcctatt
gaagagtggtttcatactgatttgggatatcttttagatgaatatttaacaaatcaagat
ttttttgataagcaatatattttaaatttagttcaagattttagagataaaaagagagta
aattttgctaaaatttggcatattttactatttttgatgtggaaaaaaaggtggaacata
tga

DBGET integrated database retrieval system