KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_1734Help
Entry
CFF8240_1734      CDS       T00430                                 

Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Brite
Enzymes [BR:cff01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CFF8240_1734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1690212..1691027
Genome map
AA seq 271 aa AA seqDB search
MFGQIRDEIFMPLTQQKAYNKQKADLGKELFRDKRLSKDKTISCETCHNLEITATGTSNQ
KLLNPPTLLNSSLNFIFSSKGDIKNLSEQIKKSLTSDKELNSQEEFIVSQINKNPKYEAK
FKNLYKDGVTFENSVDALTEFIKALTTPLSRFDKFLAGDKTALSDDEQKGLDIFIRSGCV
SCHNGINLGGNIISIMKNEMINTNEILKVPTLRNISLTKPYFHDGRVNKLRDAIEMIRSR
IHSRKHNEEECELIYKFLLTLEGNTPEILYE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgtttggacagatcagagatgagatatttatgcctcttacgcagcaaaaagcatataac
aagcaaaaagcagatctaggaaaagagctttttagagataaaagactaagcaaagataaa
actatctcttgtgaaacttgtcataatcttgaaatcaccgcaaccggaacttcaaatcaa
aaactgttaaatcctccgactctgctgaattcctctttaaattttatattttctagtaaa
ggagatataaaaaatctcagtgaacagataaaaaaatcattaactagcgataaagaactt
aacagtcaagaggaatttatagtatctcaaataaacaaaaatcctaaatatgaagctaaa
tttaaaaatctctacaaagacggcgtgacatttgaaaattcagtagatgctttaactgag
tttatcaaagcacttactacgccgcttagtcgttttgataaatttttagcaggagataaa
accgcactcagcgatgacgaacaaaaaggacttgatatatttataagatctggctgcgtt
agctgtcataacggaataaatttaggcggaaatataataagcattatgaaaaatgaaatg
ataaatacaaacgagatattaaaagtgccaacgctaagaaacatctctcttacaaaaccg
tattttcacgatggacgcgtaaataagcttagagacgctatcgaaatgataagatcaagg
atacactcgagaaaacacaacgaggaagagtgcgaactgatatataaatttctacttact
ttagagggaaacactccggagatattatatgaataa

DBGET integrated database retrieval system