KEGG   Cellulomonas fimi: Celf_0079Help
Entry
Celf_0079         CDS       T01490                                 

Definition
fumarate reductase/succinate dehydrogenase flavoprotein domain-containing protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cfi  Cellulomonas fimi
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(94494..96212)
Genome map
AA seq 572 aa AA seqDB search
MTSSADGRDVLVVGSGFGGAVAALRLSEKGYRVTVLEAGRRFTPETLPRTSWDVRRFLWA
PRLGCHGIQRIHVLRDVVVLAGAGVGGGSLVYANTLYEPRSDAFFEDPQWASITRWREEL
APHYDQARRMLGVVENPVDSPADAVVRAAARDLGVAHTYRRAPVGVVFGAPGARVPDPFF
GGVGPERHACTQCGECMTGCRHGAKNTLETNYLWLAERAGARVVPDTTVDALRPRPGGGY
DVDVHRTGRPGGHRTLRADQVVVAAGAWGTQVLLHRMKADGVLPHLSDRLGTLTRTNSEA
LGGAVRRLRGARRRTPLNSGVAITSSVWLDDRTHLEPVRYGRGSNLMGLLGTVLTDGGGR
VPRPLRWAGQVLRHPGQVASVLLGIRSWSERTVIGLVMQTGDSSITVRPRRTWRGRWRLT
STPGAGEPNPTWLPQANAAYRAMARHVDGAAMGSLGEVVDVPMTAHFIGGCTIGETAATG
VVDAYHRAFGHPGLHVMDGSTISANLGVNPSLTITAQAERACALWPNAGDPDPRPPLGSR
YVRLDPVAPRHPAVPPGARAALHLTVVRRSPA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgacgagctcggcggacggccgcgacgtgctcgtcgtgggctccgggttcggcggtgcc
gtcgcggccctgcggctgtccgagaaggggtaccgcgtcacggtcctggaggccgggcgc
cggttcacgcccgagacgctgccgcgtacctcgtgggacgtgcggcgtttcctgtgggcg
ccgcggctcggctgccacggcatccagcggatccacgtgctgcgcgacgtcgtcgtgctc
gccggggcgggcgtcggcggcggctcgctcgtctacgccaacacgctctacgagccgcgg
tccgacgcgttcttcgaggatccgcagtgggcgtcgatcacgcgctggcgcgaggagctc
gcgccgcactacgaccaggcgcgacgcatgctcggcgtcgtcgagaaccccgtcgactcc
cccgcggacgccgtcgtgcgcgcggctgcgcgggacctgggcgtcgcgcacacctaccgg
cgcgcgcccgtcggggtggtgttcggcgcgccgggcgcacgcgtgccggacccgttcttc
ggcggcgtcggccccgagcggcacgcgtgcacccagtgcggcgagtgcatgaccggctgc
cggcacggcgccaagaacacgctcgagaccaactacctgtggctcgcggagcgtgccggc
gcgcgggtcgtcccggacacgaccgtcgacgcgctgcggccgcgccccggcggcgggtac
gacgtcgacgtgcaccgcaccggccggcccggcgggcaccgcacgctgcgcgcggaccag
gtcgtcgtcgccgcgggtgcatggggcacgcaggtgctgctgcaccggatgaaggccgac
ggcgtcctgccgcacctgtccgaccggctcgggaccctcacgcgcaccaactccgaggct
ctcggcggggccgtccgccggctgcgcggcgcgcgtcgtcgcacgccgctcaacagcggc
gtcgccatcacgtcgtccgtctggctcgacgaccgcacgcacctggagcccgtgcggtac
ggccgcggctcgaacctcatggggctgctcggcaccgtgctcaccgacggcggcgggcgc
gtgccgcggccgctgcggtgggccgggcaggtgctgcggcaccccgggcaggtcgcctcg
gtgctgctcgggatccgctcgtggtccgagcgcaccgtcatcgggctcgtcatgcagacg
ggcgactcctcgatcaccgtccggccgcggcgcacgtggcgtggtcgctggcgtctcacg
tccacgccgggggcgggcgagccgaacccgacgtggctcccgcaggcgaacgcggcctac
cgcgcgatggcccggcacgtcgacggtgccgccatgggcagcctgggcgaggtcgtggac
gtcccgatgaccgcgcacttcatcggcgggtgcacgatcggggagaccgccgcgacgggc
gtcgtggacgcgtaccaccgcgccttcggccaccccgggctgcacgtcatggacggctcg
accatctcggcgaacctcggcgtcaacccgtcgctcaccatcaccgcgcaggccgagcgc
gcgtgcgcgctgtggccgaacgcgggcgaccccgacccccgcccgccgctcgggtcgcgc
tacgtccggctcgacccggtcgccccgcggcacccggcggtgcctcccggggcacgggcg
gcgctgcacctgaccgtggtgcgccgctcgcccgcgtga

DBGET integrated database retrieval system