KEGG   Cellulomonas fimi: Celf_0236Help
Entry
Celf_0236         CDS       T01490                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00860  Porphyrin and chlorophyll metabolism
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01120  Microbial metabolism in diverse environments
Module
cfi_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Celf_0236
Enzymes [BR:cfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Celf_0236
Exosome [BR:cfi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Celf_0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AEE44382
JGI: Celf_0236
UniProt: F4H670
Position
complement(262426..263424)
Genome map
AA seq 332 aa AA seqDB search
MTPPTPRPGRIRPRRLRATPAMRRLTSETRLHPAQLVLPLFLREGLDEPRPIASMPGVLQ
HTRDSLRQAVGDAARAGLGGVMLFAVPEHRDAVGSQATAPDGILNVAIADAVAEAGDALV
VQADLCLDEFTDHGHCGVLTPTGAVDNDATLVRYAEMALAQAAAGAHLVGLSGMMDGQVG
VVRDALDDAGHDQVAVLAYAAKYASAFYGPFRDAVESQLEGDRRTYQMDPANRREAAREV
ALDIAEGADVVMVKPALAYLDVLADVAAMSTVPVSAYQVSGEYAMIEAAAAHGWIERERA
ILESVLSIRRAGADHVLTYFATELAGWLAEEN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgacaccccccaccccccgccccggccgtatccgcccgcgccggctgcgcgccacgccc
gcgatgcgccgcctgaccagcgagacccgcctgcaccccgcgcagctcgtgctgccgctg
ttcctgcgcgaggggctcgacgagccacgcccgatcgcctccatgcccggcgtcctgcag
cacacgcgcgactcgctgaggcaggcggtgggcgacgcggcccgcgcagggctcggcggc
gtcatgctgttcgccgtcccggagcaccgcgacgcggtcgggtcccaggccaccgcgccg
gacggcatcctcaacgtcgcgatcgcggacgcggtcgcggaggcgggcgacgcgctcgtc
gtgcaggcggacctgtgcctggacgagttcaccgaccacgggcactgcggcgtgctgacg
cccacgggggccgtcgacaacgacgcgacgctcgtgcggtacgcggagatggcgctcgcg
caggccgcggccggggcgcacctcgtcgggctcagcggcatgatggacggccaggtcggc
gtggtgcgcgacgcgctcgacgacgcgggccacgaccaggtcgcggtgctcgcgtacgcg
gcgaagtacgcgtccgcgttctacgggccgttccgcgacgcggtcgagtcgcagctcgag
ggcgaccgccggacgtaccagatggaccccgcgaaccgccgggaggcggcgcgcgaggtc
gcgctcgacatcgcggagggcgcggacgtcgtcatggtcaagccggcactggcgtacctc
gacgtgctcgcggacgtcgcggccatgtcgacggttccggtcagcgcctaccaggtgtcg
ggcgaatacgcgatgatcgaggccgccgccgcgcacggatggatcgagcgcgaacgggcg
atcctggagtccgtgctcagcatccggcgtgccggtgccgatcacgtgctcacgtacttc
gcgacggagctggccgggtggctggcggaggagaactga

DBGET integrated database retrieval system