KEGG   Cellulomonas fimi: Celf_0254Help
Entry
Celf_0254         CDS       T01490                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00010  Glycolysis / Gluconeogenesis
cfi00020  Citrate cycle (TCA cycle)
cfi00620  Pyruvate metabolism
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01120  Microbial metabolism in diverse environments
cfi01130  Biosynthesis of antibiotics
cfi01200  Carbon metabolism
Module
cfi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celf_0254
   00020 Citrate cycle (TCA cycle)
    Celf_0254
   00620 Pyruvate metabolism
    Celf_0254
Enzymes [BR:cfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Celf_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEE44399
JGI: Celf_0254
UniProt: F4H687
Position
281438..283045
Genome map
AA seq 535 aa AA seqDB search
MPTYQQFPLPDAGEGLTEAEIVAWHVAVGDAVEVNQTIVEIETAKSLVDLPSPWTGVVTA
ILVEPGQTVDVGTPIIEIDTDPTGTPAPAPAHGGAIEHGHRGGGDRHSGVEPGGADEVAA
VRDQALSADHTSQRAAAGLGGTHPQRAAAGLHVPAASAAAGGTTPAAGNAAGEAREAVLV
GYGLADPSGSRRARATAAPADAAPADAAPSATPAAAGPHVPAVARPATPTPPARRHALAK
PPVRKLARELGVDLDSVDPTGPGGIVTREDVLARAAQAEARTLATYPGDDQPWLASGAVS
NDGRQTRVPVKSVRKRTAEAMVTSAFTAPHVTVFQTVDVTRTMRLVERLRGDREFADVRV
TPLLIAAKALMLAVRRHPEINASWDEAAQEIVYKHYINLGIAAATPRGLVVPNVKDAHRL
DLLDLARALGDLTATARAGRTSPTDMSDGTITITNVGVFGIDTGTPILNPGEAAILAFGA
IREQPWVHKGKVKPRHVTQLALSFDHRLVDGELGARVLADVAAVLADPAQGLVWG
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
gtgccgacgtaccagcagttcccgctccccgacgccggggagggcctcaccgaggccgag
atcgtcgcgtggcacgtggcggtcggggacgccgtcgaggtgaaccagacgatcgtcgag
atcgagaccgcgaagtcgctcgtcgacctgccgagcccgtggacgggcgtcgtcacggcg
atcctcgtcgagcccggccagacggtcgacgtgggcacgccgatcatcgagatcgacacc
gacccgaccggcacacccgcgcccgcgccggcgcacggcggcgcgatcgagcacgggcac
cgcggcggtggcgaccggcacagcggcgtcgagccgggcggtgcggacgaggtcgcggcg
gtacgggaccaggcgctctccgccgaccacacgtcgcagcgcgccgccgccgggctcggc
gggacgcacccgcagcgtgccgcggcggggctgcacgtgcccgccgcgagcgccgcggcc
ggtggcacgaccccggccgcggggaacgccgcaggggaggcgcgcgaggcggtgctcgtc
gggtacgggctcgccgacccgtccggctcgcgccgggcacgcgccaccgcggctccggcc
gacgcggcaccggccgacgcggctccgtccgcgaccccagccgcggcggggccgcacgtg
cccgccgtcgcgcgcccggccacgccgacccctcccgcccgacggcacgccctcgccaag
cctccggtccgcaagctcgcgcgcgagctcggcgtcgacctcgactccgtcgacccgacc
gggcccggcgggatcgtcacgcgtgaggacgtcctcgcccgcgccgcccaggcggaggcc
cgcacgctcgcgacgtaccccggcgacgaccagccgtggctcgcctccggcgcggtgtcg
aacgacggccgccagacccgcgtccccgtgaagtccgtgcgcaagcggaccgccgaggcc
atggtgaccagcgcgttcacggcgccgcacgtcaccgtcttccagaccgtcgacgtgacg
cgcaccatgcggctcgtcgaacggctgcgcggtgaccgcgagttcgccgacgtgcgggtc
acgcccctgctgatcgccgcgaaggccctcatgctggccgtgcgccgccaccccgagatc
aacgcgtcgtgggacgaggccgcgcaggagatcgtctacaagcactacatcaacctcggc
atcgccgccgcgaccccccgcgggctcgtcgtgccgaacgtcaaggacgcccaccggctc
gacctgctcgacctggcccgcgctctcggggacctcaccgcgaccgcgcgcgccggccgc
acgtcgccgacggacatgtccgacggcacgatcaccatcaccaacgtcggcgtcttcggc
atcgacacgggcaccccgatcctcaacccgggtgaggccgcgatcctcgcgttcggcgcg
atccgcgagcagccgtgggtccacaagggcaaggtcaagccgcggcacgtcacgcagctc
gccctgagcttcgaccaccggctcgtcgacggcgagctgggcgcccgggtcctggccgac
gtcgccgccgtcctggccgacccggcgcagggactggtctggggctga

DBGET integrated database retrieval system