KEGG   Cellulomonas fimi: Celf_0438Help
Entry
Celf_0438         CDS       T01490                                 

Definition
Ricin B lectin
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cfi  Cellulomonas fimi
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cfi00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cfi00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cfi00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(476010..477695)
Genome map
AA seq 561 aa AA seqDB search
MRSPRRWTTTLATAALTVCAVGLGTGADAAAPRAPGAAAVPLAAPTVDEPAPLPPLGWNS
WNTFYCNIDEQMIRQTADAMVSSGMAAAGYQYVVVDDCWMQDTRDANGNLRARTDRFPSG
MKALGDYIHSKGLKFGIYHAPREKTCNQYFANLPGTSSYGREAQDATLFASWGVDYVKHD
WCDPRGSATEQAAVFQRFGAALKATGRPIVYSINPNSAHSNTAPTYSGWGAFSDMWRTSE
DLSASWSTGCAPSADCFVGITEALDIVEPMREWTRPGQYNDPDMLMVGVRNALTATENRA
HMSMWAMLGAPLIAGNDLRSMSADVRAVLTNRDVLAIDQDPLVRQADRVRDDGDAEVWAK
PLADGSVAVALLNRGSGTRQISTTLGQVGLGAGTYQYREVWTGATGSTTGQISAQVAQHG
VALFRVGAGGTTPPPTGTALVSASSGRCLDVPGSATANGTGLVIWDCHTAANQTWTAGAD
GTLRSLGKCLDAPPSATAGTRVQLWDCNGGTNQQWTSQADGTIRGARSGLCLDVDRNLTA
NSTAVLLWTCTGAVNQRWSRR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
gtgagaagtcctcgtcgctggaccacgacgctggccacggccgccctgaccgtctgcgcc
gtcggcctcgggacgggcgccgacgcggccgccccgcgggcccctggcgccgcggcggtc
ccgctcgctgcacccacagtcgacgagcccgctcccttgccgccgctcggctggaacagc
tggaacacgttctactgcaacatcgacgagcagatgatccggcagacggcggacgcgatg
gtgagctcggggatggccgccgccgggtaccagtacgtcgtcgtcgacgactgctggatg
caggacacccgcgacgcgaacggcaacctgcgggcacggaccgaccgcttcccgtcgggg
atgaaggcgctgggcgactacatccacagcaaggggctgaagttcgggatctaccacgcg
ccgcgcgagaagacgtgcaaccagtacttcgcgaacctcccgggcacgtcgtcgtacggg
cgcgaggcgcaggacgcgaccctcttcgcgtcgtggggcgtcgactacgtcaagcacgac
tggtgcgacccgcgcggcagcgcgaccgagcaggcggccgtcttccagcggttcggcgcc
gcgctcaaggccaccggccgcccgatcgtctactcgatcaacccgaacagcgcgcactcc
aacacggccccgacgtactccggctggggcgcgttctcggacatgtggcggacctccgag
gacctgtcggcctcgtggtcgaccggctgcgcgccatccgccgactgcttcgtcgggatc
accgaggcgctggacatcgtcgagccgatgcgcgagtggacgaggccgggccagtacaac
gaccccgacatgctgatggtgggcgtgcggaacgcgctcaccgccaccgagaaccgggcc
cacatgagcatgtgggcgatgctcggcgctcccctgatcgccggcaacgacctgcgcagc
atgagcgccgacgtgcgcgcggtgctcaccaaccgcgacgtcctcgcgatcgaccaggac
ccgctcgtgcggcaggccgaccgcgtgcgggacgacggcgacgccgaggtgtgggcgaag
ccgctcgcggacggctccgtcgccgtcgcgctgctcaaccgcggctctggcacccggcag
atctcgaccacgctcgggcaggtcggcctcggtgccgggacgtaccagtaccgcgaggtg
tggaccggcgcgacgggctcgacgacgggccagatctccgcgcaggtcgcccagcacggc
gtggccctgttccgggtcggtgccggcggcacgaccccgccgccgaccggcaccgcgctc
gtcagcgcgtcgtcggggcgctgcctcgacgtgcccggcagcgcgaccgcgaacggcacc
gggctcgtgatctgggactgccacaccgcagccaaccagacctggaccgccggcgcggac
ggcaccctccgctcgctcggcaagtgcctcgacgcgccgccgagcgcgaccgcgggcacg
cgcgtgcagctctgggactgcaacggcggcaccaaccagcagtggacgtcccaggccgac
ggcacgatccgtggcgcccggtccgggctgtgcctggacgtcgaccggaacctcacggcc
aacagcacggccgtgctgctgtggacctgcacgggagcggtgaaccagcgctggtcgcgc
cggtag

DBGET integrated database retrieval system