KEGG   Cellulomonas fimi: Celf_0438Help
Entry
Celf_0438         CDS       T01490                                 

Definition
Ricin B lectin
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cfi  Cellulomonas fimi
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Celf_0438
  Lipid metabolism
   00561 Glycerolipid metabolism
    Celf_0438
   00600 Sphingolipid metabolism
    Celf_0438
Enzymes [BR:cfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Celf_0438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(476010..477695)
Genome map
AA seq 561 aa AA seqDB search
MRSPRRWTTTLATAALTVCAVGLGTGADAAAPRAPGAAAVPLAAPTVDEPAPLPPLGWNS
WNTFYCNIDEQMIRQTADAMVSSGMAAAGYQYVVVDDCWMQDTRDANGNLRARTDRFPSG
MKALGDYIHSKGLKFGIYHAPREKTCNQYFANLPGTSSYGREAQDATLFASWGVDYVKHD
WCDPRGSATEQAAVFQRFGAALKATGRPIVYSINPNSAHSNTAPTYSGWGAFSDMWRTSE
DLSASWSTGCAPSADCFVGITEALDIVEPMREWTRPGQYNDPDMLMVGVRNALTATENRA
HMSMWAMLGAPLIAGNDLRSMSADVRAVLTNRDVLAIDQDPLVRQADRVRDDGDAEVWAK
PLADGSVAVALLNRGSGTRQISTTLGQVGLGAGTYQYREVWTGATGSTTGQISAQVAQHG
VALFRVGAGGTTPPPTGTALVSASSGRCLDVPGSATANGTGLVIWDCHTAANQTWTAGAD
GTLRSLGKCLDAPPSATAGTRVQLWDCNGGTNQQWTSQADGTIRGARSGLCLDVDRNLTA
NSTAVLLWTCTGAVNQRWSRR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
gtgagaagtcctcgtcgctggaccacgacgctggccacggccgccctgaccgtctgcgcc
gtcggcctcgggacgggcgccgacgcggccgccccgcgggcccctggcgccgcggcggtc
ccgctcgctgcacccacagtcgacgagcccgctcccttgccgccgctcggctggaacagc
tggaacacgttctactgcaacatcgacgagcagatgatccggcagacggcggacgcgatg
gtgagctcggggatggccgccgccgggtaccagtacgtcgtcgtcgacgactgctggatg
caggacacccgcgacgcgaacggcaacctgcgggcacggaccgaccgcttcccgtcgggg
atgaaggcgctgggcgactacatccacagcaaggggctgaagttcgggatctaccacgcg
ccgcgcgagaagacgtgcaaccagtacttcgcgaacctcccgggcacgtcgtcgtacggg
cgcgaggcgcaggacgcgaccctcttcgcgtcgtggggcgtcgactacgtcaagcacgac
tggtgcgacccgcgcggcagcgcgaccgagcaggcggccgtcttccagcggttcggcgcc
gcgctcaaggccaccggccgcccgatcgtctactcgatcaacccgaacagcgcgcactcc
aacacggccccgacgtactccggctggggcgcgttctcggacatgtggcggacctccgag
gacctgtcggcctcgtggtcgaccggctgcgcgccatccgccgactgcttcgtcgggatc
accgaggcgctggacatcgtcgagccgatgcgcgagtggacgaggccgggccagtacaac
gaccccgacatgctgatggtgggcgtgcggaacgcgctcaccgccaccgagaaccgggcc
cacatgagcatgtgggcgatgctcggcgctcccctgatcgccggcaacgacctgcgcagc
atgagcgccgacgtgcgcgcggtgctcaccaaccgcgacgtcctcgcgatcgaccaggac
ccgctcgtgcggcaggccgaccgcgtgcgggacgacggcgacgccgaggtgtgggcgaag
ccgctcgcggacggctccgtcgccgtcgcgctgctcaaccgcggctctggcacccggcag
atctcgaccacgctcgggcaggtcggcctcggtgccgggacgtaccagtaccgcgaggtg
tggaccggcgcgacgggctcgacgacgggccagatctccgcgcaggtcgcccagcacggc
gtggccctgttccgggtcggtgccggcggcacgaccccgccgccgaccggcaccgcgctc
gtcagcgcgtcgtcggggcgctgcctcgacgtgcccggcagcgcgaccgcgaacggcacc
gggctcgtgatctgggactgccacaccgcagccaaccagacctggaccgccggcgcggac
ggcaccctccgctcgctcggcaagtgcctcgacgcgccgccgagcgcgaccgcgggcacg
cgcgtgcagctctgggactgcaacggcggcaccaaccagcagtggacgtcccaggccgac
ggcacgatccgtggcgcccggtccgggctgtgcctggacgtcgaccggaacctcacggcc
aacagcacggccgtgctgctgtggacctgcacgggagcggtgaaccagcgctggtcgcgc
cggtag

DBGET integrated database retrieval system