KEGG   Cellulomonas fimi: Celf_0540Help
Entry
Celf_0540         CDS       T01490                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cfi  Cellulomonas fimi
Brite
Enzymes [BR:cfi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Celf_0540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT GCD14 Methyltransf_25 Fibrillarin Methyltransf_23 Methyltransf_11 Methyltransf_31 Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: AEE44680
JGI: Celf_0540
UniProt: F4GY12
Position
complement(596099..596683)
Genome map
AA seq 194 aa AA seqDB search
MGAAPDPGRADDVADAMRALAREHFLPPDQRGRAAEDHPLPLWHGQTSSQPSTVAAMLRL
LQVPVGARVLDVGSGSGWTTALLGRLVGPTGRVLGLELDPQLAAWGAGNVAAWDMPWARV
EQAEPGVLGRAVPGGWDRVLVSAAPRELPPALVEQVAEGGRMVIPVRSTMLLVEREGGHV
RVSTHGSYTFVPLR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgccgcaccggaccccggacgcgcggacgacgtcgccgacgcgatgcgcgcgctc
gcgcgcgagcacttcctgccccccgaccagcgcggccgcgcggccgaggaccacccgctc
ccgctgtggcacggccagaccagctcgcagccgagcaccgtcgccgcgatgctgcggctc
ctccaggtgcccgtgggtgcccgtgtcctcgacgtcggcagcggctcggggtggaccacg
gcgctgctcggccggctcgtgggcccgaccggccgcgtcctggggctcgagctcgacccg
cagctcgcggcctggggtgcgggcaacgtcgccgcgtgggacatgccgtgggcgcgcgtc
gagcaggccgagcccggcgtgctcgggcgggccgtccccggcggctgggaccgcgtgctg
gtctcggcggcgccgcgcgagctgccgcccgcgctggtcgagcaggtcgccgagggcggg
cgcatggtcatcccggtgcgctcgacgatgctcctcgtggagcgcgagggcgggcacgtg
cgggtcagcacgcacgggtcgtacacgttcgtgccgctgcgctga

DBGET integrated database retrieval system