KEGG   Cellulomonas fimi: Celf_0574Help
Entry
Celf_0574         CDS       T01490                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cfi  Cellulomonas fimi
Brite
Enzymes [BR:cfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Celf_0574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
633960..638012
Genome map
AA seq 1350 aa AA seqDB search
MSRPRLFETIGVGMVALGLVAAPALGTAPPSTARAADVEVLRSDFESGTYAPWTPSGSPT
LTLVPDPDGTGTSLRVAGRTAGWQGVALDLVPLLEPGATYTVSMRARLADEAQPAAGVHF
TVDAPAASNPYTWVSGPSTLSAGAWTTISGSYTFEEGLDAARMYLDGGDTAPYPDLLLDD
VVITGQAPTDPGGVVPGGAVDPTTTPVATARGTGDVSALTFDDGPNGATTTALLDFLAER
DIRATFCVIGQNIQAPGGADVLRRIVADGHTLCNHTTSYADMGGWTAEQVRADLVENLGI
IRDALGDPDAKVPYFRAPNGSWGVTPGVAVALGMQPLAVTNTIDDWSTQDVPTLTSNLRD
AMKAGQVVLAHDGGGDRSGTLAAVQTVVDERLAAGWTFTLPTGGADGGSSVPTGLSNDFE
AGLGVWGPRGDATVTLSDDAHGGAQAALVAGRTQAWHGIGATVTDVFQTGRTYTVDAWVK
LAAGATEPADLRISVQRDNAGESTYDTVTTATGVTADAWTHVQAQYTMAAAESALLYVES
SSSLASFLVDDVVVSGSTAPPVQTDIPSLKDELPWPVGVAIDERETVGTGEQLVVKHYDQ
ITAENAMKPESIQPTEGAFTFEAGDALIDSAVANGQRVYGHTLVWHSQTPDWFFTHADGT
PLTSSAADQQILRDRMRTHIETVADHYRQKYGEYGTAGNPIVAYDVVNEAIAESESDGLR
RSRWFEVLGEQYLDLAFQYASQAFNGGDTDGPVQLFLNDYNTELPAKRQAMLDVVNRLLA
RDVPLDGLGHQFHVNLLQPVSQMKASIDAFATTGLLQAVTELDAPIDGTVSQEKLVAQGY
YYADVFDMLRQYPDLFSVTLWGPYDSRSWREGAPLPFDDDLQAKPAFWGIVDRGELPTLT
RLADAHAGTPTGVDDPTWRLLPETSFGDATGFQLRWSADGLVAYVEVADATDDGADDVVD
LFAADQHVTVHRSDAGVVATASGYRLAVPLAVAGLTQGGTVPFDVRVTDGASGERRSWND
LSHGQEDGERLGVVTLVEPVGYVAAVQASTAPVIDGVVDEAWADAPVLTTDVQVEGTPGA
TAEIRVLWHDDAVDVLATVADPVVDETATNAWEQDSVEIFVDPVNAKAGAYTPQDGQYRI
SASNAQSVSGDLAVIGERLTSATALVDGGYVVEASIALGRDVTVGDLVGLDFQVNDATAG
VRGSVRTWTDPTGRSYQSTARWGVAELVAPAVEPGPVLTLGAGSVAAGKKLAVDLAGFEP
KAKVRLVLDRVGAAPTAPSRSGLFGQLVDGLSAWYWKDVELGSVRTDADGAASATVKVPA
WVLPGDFEVKAYVAGEVVASAPVRVRPVFS
NT seq 4053 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggccacgcttgttcgaaactatcggagtcgggatggtggcgttgggcctggtg
gccgcgccggcgctcggcaccgcacccccgtccacggcccgcgccgcggacgtcgaggtc
ctccgcagcgacttcgagtccggcacgtacgcgccgtggacgccgagcggcagccccacg
ctcacgctcgtccccgacccggacgggaccggcacgagcctgcgggtcgccgggcgcacg
gcggggtggcagggcgtcgccctcgacctcgtcccgctgctcgagcccggcgcgacgtac
accgtgagcatgcgcgcgcggctcgccgacgaggcgcagcccgccgccggcgtgcacttc
accgtcgacgcgcccgccgcgtccaacccgtacacctgggtcagcggcccgagcaccctg
agcgccggcgcgtggaccacgatcagcggctcctacacgttcgaggaggggctcgatgcc
gcgcgcatgtacctcgacggcggcgacaccgcgccgtaccccgacctgctgctcgacgac
gtggtgatcaccggccaggcaccgaccgaccccggcggcgtcgtccccggcggcgcggtg
gacccgacgaccacgcccgtcgcgaccgcccgcggcacgggcgacgtgtccgccctgacg
ttcgacgacggccccaacggcgccaccaccaccgcgctgctcgacttcctcgccgagcgc
gacatccgcgcgacgttctgcgtcatcggccagaacatccaggcccccggcggcgcggac
gtgctgcggcggatcgtcgcggacggccacacgctgtgcaaccacacgacgtcctacgcc
gacatgggcggctggacggccgagcaggtgcgcgcggacctcgtcgagaacctcggcatc
atccgcgacgcgctcggtgacccggacgcgaaggtcccgtacttccgcgcccccaacggg
agctggggcgtcacgcccggcgtggccgtcgcgctcggcatgcagccgctcgcggtgacg
aacaccatcgacgactggtcgacgcaggacgtcccgacgctgacgtcgaacctgcgcgac
gccatgaaggcgggccaggtcgtgctcgcgcacgacggcggcggcgaccgctcggggacg
ctcgcggccgtgcagacggtcgtcgacgagcgcctcgcggcgggctggacgttcacgctg
cccacgggcggcgcggacggcggcagcagcgtgcccaccgggctgagcaacgacttcgag
gccggcctcggggtctggggcccgcgcggcgacgccacggtcaccctcagcgacgacgcg
cacggcggtgcccaggcggccctcgtcgccggccgcacgcaggcgtggcacggcatcggc
gcgaccgtcacggacgtgttccagacgggccgcacctacacggtcgacgcgtgggtcaag
ctcgccgcgggcgcgaccgagccggccgacctgcggatctccgtccagcgcgacaacgcg
ggcgagtccacctacgacacggtcacgaccgcgacgggcgtcaccgccgacgcgtggacg
cacgtgcaggcgcagtacacgatggccgccgccgagtcggcgctgctctacgtcgagtcg
agctcgtcgctcgcgtccttcctcgtcgacgacgtggtcgtgagcggctcgacggccccg
ccggtccagaccgacatcccgtccctcaaggacgagctgccctggcccgtcggcgtcgcg
atcgacgagcgggagaccgtcggcacgggcgagcagctcgtcgtcaagcactacgaccag
atcaccgccgagaacgccatgaagccggagagcatccagccgaccgagggcgcgttcacc
ttcgaggcgggcgacgcgctgatcgacagcgccgtcgcgaacgggcagcgtgtctacggg
cacacgctcgtgtggcacagccagacgcccgactggttcttcacgcacgccgacgggacc
ccgctgaccagcagcgccgcggaccagcagatcctgcgggaccgcatgcgcacgcacatc
gagacggtcgccgaccactaccggcagaagtacggcgagtacggcacggcgggcaacccg
atcgtcgcctacgacgtcgtcaacgaggcgatcgcggagagcgagagcgacggcctgcgc
aggagccgctggttcgaggtgctcggcgagcagtacctcgacctcgcgttccagtacgcc
agccaggcgttcaacggcggcgacaccgacggcccggtgcagctcttcctcaacgactac
aacaccgagctgcccgccaagcggcaggcgatgctcgacgtcgtgaaccggctgctcgcg
cgggacgtcccgctcgacggcctcggccaccagttccacgtcaacctgctgcagcccgtc
tcgcagatgaaggcgagcatcgacgcgttcgcgacgaccggcctgctgcaggccgtcacc
gagctcgacgcgccgatcgacgggaccgtctcgcaggagaagctggtcgcgcagggctac
tactacgccgacgtgttcgacatgctccggcagtacccggacctgttctcggtgacgctg
tggggcccgtacgacagccggtcgtggcgcgagggcgcaccgctgccgttcgacgacgac
ctgcaggccaagccggccttctggggcatcgtcgaccgcggcgagctcccgacgctgacc
cggctcgccgacgcgcacgcgggcaccccgaccggggtggacgacccgacgtggcggctg
ctgcccgagacgtcgttcggcgacgcgacgggcttccagctgcgctggtcggccgacggg
ctcgtcgcgtacgtcgaggtggcggacgcgaccgacgacggcgccgacgacgtcgtggac
ctgttcgcggcggaccagcacgtcaccgtgcaccgctccgacgcgggcgtcgtggcgacc
gcgtcgggctaccgcctggccgtgccgctcgcggtcgcgggcctgacgcagggcgggacc
gtgccgttcgacgtgcgcgtcaccgacggcgcgtcgggggagcggcgctcgtggaacgac
ctgtcccacgggcaggaggacggcgagcgcctcggcgtcgtcacgctcgtcgaaccggtc
gggtacgtggcggccgtgcaggcgtccaccgcgcccgtgatcgacggcgtggtcgacgag
gcctgggccgacgcgcccgtcctcacgacggacgtgcaggtcgagggcacccccggtgcg
acggcggagatccgggtgctgtggcacgacgacgcggtcgacgtgctcgcgacggtcgca
gacccggtcgtcgacgagaccgcgaccaacgcgtgggagcaggactcggtcgagatcttc
gtcgacccggtcaacgccaaggcgggcgcgtacacgccgcaggacggccagtaccggatc
agcgcgagcaacgcgcagtcggtcagcggcgacctcgcggtcatcggggagcggctcacg
tccgcgacggcgctcgtcgacggcgggtacgtcgtcgaggcgtcgatcgcgctcggccgc
gacgtgaccgtgggcgacctcgtcggcctggacttccaggtcaacgacgcgaccgcgggc
gtgcgcgggtcggtccggacatggacggacccgacgggccgctcgtaccagagcaccgcc
cggtggggcgtcgcggagctcgtcgccccggccgtcgagccgggccccgtgctgacgctc
ggggcgggctcggtggccgcgggcaagaagctcgcggtggacctcgcgggcttcgagccg
aaggccaaggtgcgcctggtcctcgaccgcgtcggtgccgcgcccacggccccgagccgg
tcgggcctgttcgggcagctcgtcgacgggctgagcgcctggtactggaaggacgtcgag
ctcgggtcggtccgcaccgacgccgacggcgccgcgagcgccacggtgaaggtgccggcg
tgggtgctgccgggcgacttcgaggtcaaggcgtacgtcgccggggaggtggtcgcgagc
gccccggtgcgggtgcggcccgtcttctcgtga

DBGET integrated database retrieval system