KEGG   Cellulomonas fimi: Celf_0585Help
Entry
Celf_0585         CDS       T01490                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00010  Glycolysis / Gluconeogenesis
cfi00260  Glycine, serine and threonine metabolism
cfi00680  Methane metabolism
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01120  Microbial metabolism in diverse environments
cfi01130  Biosynthesis of antibiotics
cfi01200  Carbon metabolism
cfi01230  Biosynthesis of amino acids
Module
cfi_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celf_0585
  Energy metabolism
   00680 Methane metabolism
    Celf_0585
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celf_0585
Enzymes [BR:cfi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Celf_0585
Membrane trafficking [BR:cfi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Celf_0585
Exosome [BR:cfi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Celf_0585
  Exosomal proteins of melanoma cells
   Celf_0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEE44725
JGI: Celf_0585
UniProt: F4GY57
Position
654142..654882
Genome map
AA seq 246 aa AA seqDB search
MTYTLVLLRHGESEWNAKNLFTGWVDVALSEKGVEEAKRGGKLLTDAGVLPDVVHTSLLR
RAITTANYALDAADRLWIPVKRSWRLNERHYGALQGKDKKQTLAEYGEEQFMLWRRSYDV
PPPDIELGSEFSQDSDPRYAGEPIPRAEALAQVLERALPYWESDVVPDLKARKTVLVAAH
GNSIRAIVKHLDDVDADTIAGINIPTGIPLLYELDEETLQPVTKGGTYLDPEAAAEAIKA
VANQGR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaccctcgtgctgctccgccacggcgagagcgagtggaacgccaagaacctg
ttcaccggctgggtggacgtcgccctgtcggagaagggcgtcgaggaggcgaagcgcggc
ggcaagctgctcacggacgcgggcgtcctgcccgacgtcgtgcacacgtcgctcctgcgc
cgcgcgatcacgaccgcgaactacgcgctcgacgccgcggaccgcctctggatcccggtg
aagcgcagctggcgcctcaacgagcgccactacggcgcgctgcagggcaaggacaagaag
cagaccctcgcggagtacggcgaggagcagttcatgctctggcgccgctcctacgacgtc
ccgccgccggacatcgagctcggctcggagttctcgcaggacagcgacccgcgctacgcg
ggcgagccgatcccgcgcgccgaggcgctcgcgcaggtcctcgagcgggcgctgccgtac
tgggagtcggacgtcgtgccggacctcaaggcccgcaagacggtcctcgtcgccgcgcac
ggcaactcgatccgcgcgatcgtcaagcacctcgacgacgtcgacgccgacaccatcgcc
ggcatcaacatcccgacgggcatcccgctgctctacgagctggacgaggagaccctccag
cccgtgacgaagggcggcacgtacctcgaccccgaggccgccgccgaggccatcaaggcg
gtcgcgaaccagggtcgctga

DBGET integrated database retrieval system