KEGG   Cellulomonas fimi: Celf_0708Help
Entry
Celf_0708         CDS       T01490                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
cfi  Cellulomonas fimi
Pathway
cfi02020  Two-component system
cfi02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Celf_0708
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Celf_0708
Enzymes [BR:cfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Celf_0708
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Celf_0708
Two-component system [BR:cfi02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Celf_0708
Bacterial motility proteins [BR:cfi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Celf_0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: AEE44848
JGI: Celf_0708
UniProt: F4GZC7
Position
777872..779020
Genome map
AA seq 382 aa AA seqDB search
MSRVRVLVVDDSVVVRRIVSDVLAADPRIEVVGVAANGRLAQAKVEQLQPDLVTMDVEMP
EMDGIEAVAALRAAGHRMPVVMFSTLTERGAIATLDALAAGATDYVTKPHGTGSVAEALA
RVARELVPKIIALVPRDAEPVAPTGRPLPRLAAPRAATGAPATAAPARRPLREPAPHPVQ
LVVVGSSTGGPEALSRLLRGFTTPPRVPVLVVQHMPPVFTRQLAARLDRLGPTTVVEAAH
DEPLRPGHVYIAPGDRHLVVDTRTGMLRTALTDAPPINFCRPAVDVLFRSAVKAVRGEIL
AVVLTGMGADGRDGCADVVEAGGTVLVQDRATSVVWGMPGAVAAAGLAHRVLPIDDVAGA
VQDVLSARGTDHRSPDPSGAPR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcgtccgggtgctcgtcgtcgacgactcggtcgtggtgcggcgcatcgtcagc
gacgtcctcgccgccgacccgcgcatcgaggtcgtcggcgtcgccgccaacggccggctc
gcgcaggcgaaggtcgagcagctccagcccgacctggtgacgatggacgtcgagatgccg
gagatggacggcatcgaggcggtcgccgcgctgcgtgccgccgggcaccgcatgcccgtc
gtcatgttctccacgctcaccgagcggggcgcgatcgcgacgctcgacgcgctcgccgcg
ggcgccacggactacgtgaccaagccgcacggcaccggctcggtcgccgaggccctggcg
cgcgtggcccgcgagctggtgccgaagatcatcgcgctcgtcccgcgcgacgccgaaccc
gtcgcgcccacgggccgcccgctgccgcggctcgccgcgccgcgcgccgccacgggcgcc
ccggcgaccgccgcaccggcccggcgcccgctgcgcgagcccgcaccgcacccggtgcag
ctcgtcgtcgtcgggtcgtcgaccggcgggcccgaggccctgtcccggctgctgcgcggg
ttcaccacgccgccgcgggtgccggtcctcgtcgtgcagcacatgccgcccgtgttcacg
cgccagctcgccgcgcgcctcgaccggctcggcccgacgaccgtcgtcgaggccgcgcac
gacgagccgctgcgccccgggcatgtgtacatcgcccccggcgaccggcacctcgtcgtc
gacacccgcaccggcatgctgcgcaccgcgctgacggacgcgccgccgatcaacttctgc
cgccccgcggtcgacgtgctgttccgctccgccgtcaaggccgtgcgcggcgagatcctc
gccgtcgtcctcaccggcatgggcgcggacgggcgcgacgggtgcgccgacgtcgtcgag
gccggcggcaccgtcctcgtccaggaccgcgcgacgagcgtcgtgtgggggatgccgggc
gccgtcgccgcggccgggctggcccaccgggtcctgcccatcgacgacgtcgcgggggcc
gtgcaggacgtcctgtcggcccgcggcaccgaccaccgatcacccgacccgagcggagca
ccgcgatga

DBGET integrated database retrieval system