KEGG   Cellulomonas fimi: Celf_1113Help
Entry
Celf_1113         CDS       T01490                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00020  Citrate cycle (TCA cycle)
cfi00640  Propanoate metabolism
cfi00660  C5-Branched dibasic acid metabolism
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01120  Microbial metabolism in diverse environments
cfi01130  Biosynthesis of antibiotics
cfi01200  Carbon metabolism
Module
cfi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celf_1113
   00640 Propanoate metabolism
    Celf_1113
   00660 C5-Branched dibasic acid metabolism
    Celf_1113
Enzymes [BR:cfi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Celf_1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEE45248
JGI: Celf_1113
UniProt: F4H2M2
Position
1209298..1210479
Genome map
AA seq 393 aa AA seqDB search
MDLFEYQARDIFEKHGVPVLGGIVATTPDEAREAATRLLPAEGGVVVVKAQVKTGGRGKA
GGVKLARSADEAAEKAGEILGMDIKGHTVHRVMIAAGAKIAQEFYFSLLLDRAERRYLAM
ASVEGGMEIEQLAVERPEALARVAVDPRTGIDQAKADEIVAAAGFAPEIAGEVADVLQKL
WLVYRDEDATLVEVNPLVLTEDGEVVALDGKVTLDANADFRHADHEALEDKAAADPLEAR
AKEKDLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEAHGGVKPANFLDIGGGASAEVMA
AGLDIILTDPQVKSVFVNVFGGITACDAVANGIVAALEILGDEASKPLVVRLDGNNVLEG
RRILADAGHPLVTLADTMDGGADEAARLAHAAA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaggcacgtgacatcttcgagaagcacggcgtgcccgtgctc
ggcggcatcgtcgccacgacccccgacgaggcccgcgaggccgcgacccgcctgctgccc
gccgagggcggcgtcgtggtcgtcaaggcccaggtgaagaccggtggccgcggcaaggcc
ggcggcgtcaagctcgcccggtccgccgacgaggcggctgagaaggccggcgagatcctc
ggcatggacatcaagggacacacggtccaccgcgtgatgatcgcggcgggcgcgaagatc
gcgcaggagttctacttctcgctgctgctggaccgcgccgagcgccgctacctcgcgatg
gcgtccgtcgagggcggcatggagatcgagcagctcgcggtcgagcgccccgaggcgctc
gccagggtcgcggtcgacccgcgcaccggcatcgaccaggcgaaggccgacgagatcgtc
gccgccgcgggcttcgcgcccgagatcgcgggcgaggtcgcggacgtcctgcagaagctc
tggctcgtctaccgtgacgaggacgccacgctcgtcgaggtcaacccgctggtcctcacg
gaggacggcgaggtcgtcgcgctcgacggcaaggtcaccctcgacgccaacgcggacttc
cggcacgccgaccacgaggcgctcgaggacaaggccgccgccgacccgctcgaggcgcgc
gccaaggagaaggacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaac
ggcgcggggctcgtcatgagcacgctcgacgtcgtggcgtacgcgggcgaggcgcacggc
ggcgtcaagcccgccaacttcctcgacatcggcggcggcgcctccgcggaggtcatggcc
gcgggcctcgacatcatcctcacggacccgcaggtcaagtcggtgttcgtcaacgtcttc
ggcggcatcaccgcgtgcgacgcggtcgcgaacggcatcgtcgcggcgctcgagatcctc
ggtgacgaggcgtcgaagccgctggtcgtgcgcctcgacggcaacaacgtgctggagggc
cgccgcatcctcgcggacgcgggccacccgctcgtcacgctcgccgacaccatggacggc
ggcgccgacgaggccgcccgcctggcgcacgccgccgcctga

DBGET integrated database retrieval system