KEGG   Cellulomonas fimi: Celf_1186Help
Entry
Celf_1186         CDS       T01490                                 

Definition
alpha amylase catalytic region
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
cfi  Cellulomonas fimi
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Celf_1186
Enzymes [BR:cfi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Celf_1186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1295771..1297312)
Genome map
AA seq 513 aa AA seqDB search
MATRNAVQLITYADRLGGDLPGLARLLRSEPFAGAFGGVHVLPFFTPYDGADAGFDPVDH
TAVDPRLGTWEDVRDLARTHDVVVDLIVNHVSAQSAAFLDVRARGDASPFAPMFLTLSSV
FPDGAREENLARIYRPRPGLPFTALRLGDRLRYVWTTFTPQQVDVDVRSEAGRAYLTSIL
DAVAAAGVGLVRLDAVGYAVKTPGTTCFMTRETFAFIEDFTAQARARGVDVLVEVHSYYR
RQVEIGRAVDLVYDFALPPLVLHALYAGDGTALAGWLRDRPRNAVTVLDTHDGIGVIDVG
PDQTVEPGDEPRPGLLTPEQVDALVAGIHARTGGASAQATGAAASNLDLYQVNSTFYDAL
GRDDHRYLAARAVQLFTPGIPQVYYVGALAGGNDVDLLARTGVGRDVNRHHYTAQEIAAD
LARPVVRALLGLCRFRNTHPAFDGDVEVTLDGPVLTLVRRGVAHPGASATLVVDLSTGAA
RVDWDGPHGRGRTEDLLHAPLDAVGTGAAGAGS
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacgcgcaacgccgtgcagctcatcacctacgccgaccggctcggcggcgacctc
cccggcctcgcgcggctgctgcgctccgagccgttcgcaggcgcgttcggcggggtgcac
gtcctgccgttcttcacgccctacgacggcgccgacgccggcttcgaccccgtcgaccac
accgccgtcgacccgcggctcggcacgtgggaggacgtccgggacctcgcgcgcacgcac
gacgtcgtggtcgacctcatcgtcaaccacgtgtcggcgcagtccgccgcgttcctcgac
gtgcgggcgcgcggcgacgcgtcgcccttcgcgccgatgttcctcacgctgtcgtcggtg
ttccccgacggcgcccgcgaggagaacctcgcccggatctaccgcccgcgtcctggcctg
ccgttcacggcgctgcggctcggcgaccggctgcggtacgtgtggacgacgttcacgccg
cagcaggtggacgtcgacgtccgttccgaggcaggccgcgcctacctgacgtcgatcctc
gacgccgtcgccgccgcgggcgtcgggctcgtgcgcctcgacgccgtcgggtacgccgtc
aagacgcccggcacgacgtgcttcatgacgcgcgagacgttcgccttcatcgaggacttc
accgcgcaggcgcgcgcccgcggcgtcgacgtgctcgtcgaggtgcactcctactaccgg
cgccaggtcgagatcgggcgcgccgtcgacctcgtctacgacttcgccctccccccgctc
gtgctgcacgcgctgtacgcgggcgacggaaccgcgctggccggctggctgcgcgaccgc
ccccgcaacgcggtcacggtgctggacacgcacgacggcatcggcgtcatcgacgtcggc
ccggaccagacggtcgagccgggcgacgagccgcgtcccgggctgctgacgcccgagcag
gtcgacgcgctcgtcgcgggaatccacgcccgcacgggcggggcctccgcgcaggcgacc
ggtgcggccgcgtccaacctcgacctctaccaggtcaactcgacgttctacgacgcgctc
ggccgcgacgaccaccgctatctcgccgcgcgcgccgtgcagctcttcacgccggggatc
ccgcaggtctactacgtcggcgcgctcgccggcggcaacgacgtcgacctgctcgcgcgg
acgggcgtcggccgggacgtcaaccggcaccactacaccgcgcaggagatcgccgccgac
ctcgcccggcccgtcgtgcgcgcgctgctcgggctgtgccggttccggaacacccacccg
gcgttcgacggtgacgtcgaggtgacgctcgacgggcccgtcctcacgctcgtgcgccgc
ggcgtcgcgcacccgggagcgtcggcgacgctcgtcgtcgacctctccacgggtgccgca
cgcgtggactgggacgggccgcacgggcgcggccggacggaggacctgctccacgccccg
ctcgacgccgtgggcaccggggcggcgggcgccggttcctag

DBGET integrated database retrieval system