KEGG   Cellulomonas fimi: Celf_1267Help
Entry
Celf_1267         CDS       T01490                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cfi  Cellulomonas fimi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Celf_1267
Enzymes [BR:cfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Celf_1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1377854..1378972
Genome map
AA seq 372 aa AA seqDB search
MSEPIDQTLAGCVVLITADRRSAELAAALGRRGATVRHAPALGMVPHIDDAALLSGTRSL
LADPPDTVVVTTGIGFRGWIEAADAAGLAEPLVEMLRGTRIVARGPKARGAIQAAGLTAD
WVAESETSAEIAQVLLDEGVAGHDIAVQHHGAGADGLDEAFAAAGARVRSLVVYRWGPPP
DPAVVTSSVRAVAGGEVDAVVFTSAPGAAAWWEAADAEGVADDIVHHCRAERVVMAAVGP
VTARPLLDRGVEPLVPDRGRLGSLVRTLVSHYGGIQALATVAGPLRVYRGAAVLDGHVLP
LTPSGLEVLRLLAGARGSVVPRDQVLAVLPGESKDPHAAEVAIARLREATGSRALIRTVV
KRGYRLELEETA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagccgatcgaccagaccctcgccgggtgcgtcgtcctgatcaccgccgaccgt
cggtcggcggagctcgctgccgccctcggccgccgcggtgccaccgtgcggcacgcgccg
gcgctcgggatggtgccgcacatcgacgacgccgcgctgctctcgggcacgcggtcgctg
ctcgccgacccgccggacacggtcgtcgtgacgacgggcatcggcttccgcggctggatc
gaggccgccgacgcggcgggtctcgccgagccgctggtcgagatgctgcgggggacccgg
atcgtggcgcgcggccccaaggcgcgcggcgcgatccaggccgcgggcctgaccgccgac
tgggtcgccgagtcggagacgagcgcggagatcgcgcaggtcctgctcgacgagggcgtg
gccgggcacgacatcgccgtgcagcaccacggtgcgggagccgacggtctcgacgaggcg
ttcgcggccgcgggcgcgcgcgtgcgcagcctggtcgtgtaccggtgggggccgccgccc
gacccggcggtcgtcacgtcgtcggtgcgcgcggtcgccgggggcgaggtcgacgcggtc
gtgttcacgtccgcgccgggcgccgccgcgtggtgggaggccgccgacgcggagggcgtg
gccgacgacatcgtccaccactgccgtgccgagcgggtcgtcatggccgccgtcggcccc
gtgaccgcgcggccgctgctcgaccgcggggtcgagcccctcgtcccggaccgtggccgg
ctcggctcgctggtccgcacgctcgtgagccactacggcggcatccaggcgctcgccacg
gtcgcggggccgttgcgcgtctaccgcggcgcggccgtgctggacggtcacgtgctgccg
ctcacgccgagcgggctcgaggtgctccgcctgctcgccggggcgcgcggctcggtcgtc
ccgcgggaccaggtgctggccgtgctgcccggcgagtcgaaggacccccacgcggcggag
gtcgcgatcgcccggctgcgggaggcgaccgggagccgggccctgatccgcacggtcgtc
aagcgtggctaccggctcgagctcgaggagaccgcatga

DBGET integrated database retrieval system