KEGG   Cellulomonas fimi: Celf_1271Help
Entry
Celf_1271         CDS       T01490                                 

Definition
glycoside hydrolase family 10
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cfi  Cellulomonas fimi
Brite
Enzymes [BR:cfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Celf_1271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1381472..1383004)
Genome map
AA seq 510 aa AA seqDB search
MIQHLPRTGPHVTGCTRHWLDEEDIMPRTTPAPGHPARGARTALRTTLAAAAATLVVGAT
VVLPAQAATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEP
SQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVAD
HFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNV
EGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITE
LDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAAL
VWDASYAKKPAYAAVMEAFGASPTPTPTTPTPTPTTPTPTPTSGPAGCQVLWGVNQWNTG
FTANVTVKNTSSAPVDGWTLTFSFPSGQQVTQAWSSTVTQSGSAVTVRNAPWNGSIPAGG
TAQFGFNGSHTGTNAAPTAFSLNGTPCTVG
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgattcagcacctcccgcggacgggcccccacgtcacagggtgcacccggcactggctc
gacgaggaggacatcatgcctaggaccacgcccgcacccggccacccggcccgcggcgcc
cgcaccgctctgcgcacgacgctcgccgccgcggcggcgacgctcgtcgtcggcgccacg
gtcgtgctgcccgcccaggccgcgaccacgctcaaggaggccgccgacggcgccggccgg
gacttcggcttcgcgctcgaccccaaccggctctcggaggcgcagtacaaggcgatcgcc
gacagcgagttcaacctcgtcgtcgccgagaacgcgatgaagtgggacgccaccgagccc
tcgcagaacagcttctccttcggcgcgggcgaccgcgtcgcgagctacgccgccgacacc
ggcaaggagctgtacggccacacgctcgtctggcactcgcagctgcccgactgggcgaag
aacctcaacggctccgcgttcgagagcgcgatggtcaaccacgtgacgaaggtcgccgac
cacttcgagggcaaggtcgcgtcgtgggacgtcgtcaacgaggcgttcgccgacggcggc
ggccgccggcaggactcggcgttccagcagaagctcggcaacggctacatcgagaccgcg
ttccgggcggcacgtgcggcggacccgaccgccaagctgtgcatcaacgactacaacgtc
gagggcatcaacgcgaagagcaactcgctctacgacctcgtcaaggacttcaaggcgcgc
ggcgtcccgctcgactgcgtcgggttccagtcgcacctcatcgtcggccaggtgccgggc
gacttccggcagaacctgcagcggttcgcggacctgggcgtggacgtgcgcatcaccgag
ctcgacatccgcatgcggacgccctccgacgcgaccaagctcgcgacccaggcggccgac
tacaagaaggtcgtgcaggcctgcatgcaggtgacccgctgccagggcgtgaccgtctgg
ggcatcaccgacaagtactcgtgggtgccggacgtcttcccgggcgagggggccgcgctg
gtgtgggacgcgagctacgccaagaagccggcctacgccgccgtgatggaggccttcggc
gcgagcccgacgccgacgcccaccacgccgaccccgacgcccacgacgccgacgccgacc
ccgacgtccggtccggccgggtgccaggtgctgtggggcgtcaaccagtggaacaccggc
ttcaccgcgaacgtcaccgtgaagaacacgtcctccgctccggtcgacggctggacgctc
acgttcagcttcccgtccggccagcaggtcacccaggcgtggagctcgacggtcacgcag
tccggctcggccgtgacggtccgcaacgccccgtggaacggctcgatcccggcgggcggc
accgcgcagttcggcttcaacggctcgcacacgggcaccaacgccgcgccgacggcgttc
tcgctcaacggcacgccctgcacggtcggctga

DBGET integrated database retrieval system