KEGG   Cellulomonas fimi: Celf_1550Help
Entry
Celf_1550         CDS       T01490                                 

Definition
dihydrofolate reductase region
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cfi  Cellulomonas fimi
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cfi00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cfi00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1693853..1694356
Genome map
AA seq 167 aa AA seqDB search
MSLRLVWAQTPAGVIGVDNTLPWHVPEDQARFRRLTTGHPVVMGRATWESLPERFRPLPG
RRNVVLSRDAAYDAPGAEVVGSLDEALALVGEAETWVVGGGAVYALALPLAERVEVTFVD
RDVPGDTYAPVLDAADWREQDPDDGPGDWQVSRDGVTRYRFRTWVRV
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgcgcctcgtctgggcgcagacgcccgcgggcgtcatcggcgtcgacaacacg
ctgccctggcacgtcccggaggaccaggcgcgcttccgccggctcaccaccggccacccc
gtcgtcatgggccgagcgacgtgggagtcgctgcccgagcggttccggcccctgcccggt
cgtcgcaacgtcgtgctgtcccgcgacgccgcgtacgacgcgcccggggccgaggtcgtc
ggctcgctcgacgaggcgctcgcgctcgtgggcgaggccgagacgtgggtcgtcggcggg
ggagcggtctacgcgctcgcgctgccgctcgcggaacgcgtcgaggtgaccttcgtcgac
cgcgacgtcccgggcgacacgtacgcccccgtgctcgacgcggccgactggcgcgagcag
gacccggacgacggcccgggcgactggcaggtctcgcgcgacggcgtgacgcgctaccgc
ttccgcacgtgggtccgggtctga

DBGET integrated database retrieval system