KEGG   Cellulomonas fimi: Celf_1631Help
Entry
Celf_1631         CDS       T01490                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cfi  Cellulomonas fimi
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cfi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cfi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1786967..1788289
Genome map
AA seq 440 aa AA seqDB search
MITRIDLRGRVLSRRELLEELPRAEVDVEHAAEAVAPIIAGVRARGAAELRDLAERFDGV
RPRHLRVPAEAVAAALDRLDPLVRAALEETIVRVRRVHAAQRPQDFAVEVAPGATVRQRW
LPVRRVGLYVPGGLAVYPSSVVMNVVAAQEAGVGSLVVTSPPQKDEGGLPDPVVVATCAL
LGVDEVYAVGGAQAVAMLAYGAAGSQEEDGATLCEPVDVVTGPGNVYVAAAKRLVRGVVG
IDAEAGPTEIAILADGTADATHVAADLVSQAEHDPLAASVLVTTSVELAGAVEAKLAARV
EATRHRERVTTALAGSQSAIVLVDDLEAGLEVVNAYGAEHLEIQTEGASALADRVTSAGA
IFVGPWSPVSLGDYMAGSNHVLPTGGCAHFASGLGVHSFVRAVQVVEYDADALRAVADRI
VALADAEGLPAHGEAVQARF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacccgaatcgacctgcgcggtcgcgtgctgtcccgtcgtgagctgctcgaggag
ctgccccgcgcggaggtcgacgtcgagcacgccgccgaggccgtcgccccgatcatcgcg
ggcgtccgtgcgcgcggggccgcggagctgcgcgacctcgccgagcggttcgacggggtc
cgtccgcggcacctgcgcgtccccgcggaggcggtcgcggccgcgctggaccggctcgac
ccgctcgtgcgcgcggcgctcgaggagacgatcgtgcgcgtgcgccgcgtgcacgccgcg
cagcggccgcaggacttcgcggtcgaggtcgcaccgggggcgaccgtgcgccagcgctgg
ctgcccgtgcggcgtgtcggcctgtacgtgcccggcggtctcgccgtgtacccgtcgtcg
gtcgtgatgaacgtcgtcgcggcgcaggaggcgggtgtcggctcgctcgtcgtcacgtcc
ccgccgcagaaggacgagggcggcctgccggacccggtcgtggtcgcgacgtgcgcgctg
ctcggcgtcgacgaggtgtacgcggtcggcggcgctcaggcggtcgcgatgctcgcctac
ggcgcggcggggtcgcaggaggaggacggcgcgacgctgtgcgagcccgtcgacgtcgtc
accggcccgggcaacgtctacgtcgcggccgccaagcggctcgtgcggggcgtcgtcggg
atcgacgccgaggccgggccgaccgagatcgcgatcctcgcggacggcacggccgacgcg
acgcacgtcgccgccgacctcgtctcgcaggccgagcacgacccgctggccgcatcggtc
ctcgtgacgacgtcggtcgagctggccggggccgtcgaggccaagctggccgcacgcgtc
gaggccacccggcaccgtgagcgcgtgacgaccgccctggccggctcgcagtccgcgatc
gtgctggtcgacgacctggaggccggcctcgaggtcgtcaacgcgtacggggccgagcac
ctggagatccagaccgagggcgcctcggcgctcgcggaccgcgtgacgagcgcgggcgcg
atcttcgtcgggccgtggtccccggtgtcgctgggcgactacatggcgggctccaaccac
gtgctgccgacgggtgggtgcgcgcacttcgcgagcggcctgggcgtgcactcgttcgtg
cgcgcggttcaggtcgtcgagtacgacgccgacgcgctgcgcgcggtcgcggaccggatc
gtcgccctggcggacgccgaggggctgccggcgcacggcgaggcggtccaggcgcggttc
tga

DBGET integrated database retrieval system