KEGG   Cellulomonas fimi: Celf_1635Help
Entry
Celf_1635         CDS       T01490                                 

Definition
imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
Orthology
K02501  
glutamine amidotransferase [EC:2.4.2.-]
Organism
cfi  Cellulomonas fimi
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cfi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cfi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1790722..1791402
Genome map
AA seq 226 aa AA seqDB search
MREGAGYPDAVSSQPRVVVLDYGFGNVRSAVRALQRVGAQVELTADKHAATEADGLVVPG
VGAFAAVMGGLRAVGGDQVVDRRLAGGRPVLGICVGMQVMFAEGVEHGEHTDGLGEWPGV
VDRLEADVVPHMGWATVAAPAGTTLFRGLEDERFYFVHSYAARSFPLTDDPDGATPFTAP
LVTWATHGDRFVAAVENGPLAATQFHPEKSGDAGAQLLTHWVDSLR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgagggcgccgggtaccctgacgcggtgtcctcccagccccgtgtcgtcgtcctc
gactacggcttcggcaacgtccgatccgccgtgcgcgcgctgcagcgcgtcggtgcgcag
gtcgagctgacggcggacaagcacgccgcgacggaggccgacggcctggtcgtgccgggt
gtcggcgccttcgcggccgtgatgggcgggctgcgcgccgtgggcggtgaccaggtggtc
gaccggcggctcgcgggtggccggcccgtgctcggcatctgcgtcgggatgcaggtcatg
ttcgccgagggcgtcgagcacggcgagcacaccgacgggctcggggagtggcccggcgtg
gtcgaccggctcgaggccgacgtcgtcccgcacatgggctgggcgaccgtcgccgcgccc
gcgggcacgacgctgttccgcggcctggaggacgagcgcttctacttcgtgcactcgtac
gccgcccgctcgttcccgctcacggacgacccggacggggccacgccgttcaccgcaccg
ctcgtgacgtgggccacccacggcgaccgcttcgtcgccgccgtcgagaacggccccctc
gccgccacgcagttccaccccgagaagtcgggcgacgccggcgcgcagctgctgacccac
tgggtcgactcgctgcgctga

DBGET integrated database retrieval system