KEGG   Cellulomonas fimi: Celf_1658Help
Entry
Celf_1658         CDS       T01490                                 

Definition
pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cfi  Cellulomonas fimi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celf_1658
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celf_1658
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celf_1658
Enzymes [BR:cfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celf_1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1816637..1817947)
Genome map
AA seq 436 aa AA seqDB search
MTTTPDDVRPAPRTEPLGVTVPSTVPTHWYNLAADLPEPCPPALHPGTREPLTPDDLAPL
FPMALIAQEVSTERWVEIPQTVRELYALWRPSPLVRAVRLERALGTPARIYYKYEGVSPV
GSHKPNTAVAQAYYNAVEGITKLTTETGAGQWGASLSMACALLGLRCEVWQVRASYDSKP
YRRMQMETYGGVCHSSPSELTAAGRAILASDPETTGSLGMAISEAVEAAATDPAAHYALG
SVLNHVLLHQSVIGQEALAQLDEIGEGADVVFGCAGGGSNLGGLAFPFLGRNLREGTTTR
VVACEPAACPSMTQGEYRYDFGDVAGLTPLLKMHTLGKDFVPPPIHAGGLRYHGMAPMVS
HAYELGLMSAIAVEQGDAFAAGIEFARAEGIIPAPESTHAVAGAIAHARAATEPETIVIG
LSGNGILDLPAYHQYL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgcccgacgacgtgcgccccgccccccggaccgagcccctgggcgtcacc
gtcccctcgacggtcccgacgcactggtacaacctcgcggccgacctgcccgagccgtgc
ccgcccgcgctgcaccccggcacgcgcgagccgctcacccccgacgacctcgccccgctc
ttcccgatggcgctcatcgcgcaggaggtgagcaccgagcgctgggtcgagatcccgcag
acggtgcgcgagctgtacgcgctgtggcggccgtcgccgctcgtgcgcgcggtgcggctc
gagcgcgcgctgggcacgccggcgcgcatctactacaagtacgagggcgtgagcccggtc
ggctcgcacaagccgaacacggctgtcgcgcaggcgtactacaacgcggtcgaaggcatc
acgaagctcaccaccgagaccggcgccgggcagtggggcgcgtcgctgtcgatggcgtgc
gcgctgctcgggctgcggtgcgaggtgtggcaggtgcgcgcgtcctacgactccaagccg
taccggcgcatgcagatggagacgtacggcggcgtgtgccactcctcgccgtcggagctc
accgccgcgggccgggccatcctcgcgtccgacccggagacgaccgggtcgctcggcatg
gcgatcagcgaggccgtcgaggccgccgcgaccgaccccgccgcgcactacgcgctcggc
tccgtgctcaaccacgtgctcctgcaccagtccgtcatcgggcaggaggcgctcgcgcag
ctcgacgagatcggcgagggcgccgacgtcgtgttcggctgcgcgggcggcgggtccaac
ctcggcgggctcgcgttcccgttcctcggccgcaacctgcgcgaggggacgacgacgcgc
gtcgtcgcgtgcgagccggccgcgtgcccgtcgatgacgcagggcgagtaccggtacgac
ttcggcgacgtggcgggcctgaccccgctgctcaagatgcacacgctcggaaaggacttc
gtgccgccgcccatccacgcgggcggcctgcgctaccacggcatggcgccgatggtgtcg
cacgcctacgagctcgggctcatgagcgcgatcgccgtcgagcagggggacgccttcgcc
gcgggcatcgagttcgcccgcgccgaggggatcatccccgcgcccgagtcgacgcacgcc
gtcgccggggccatcgcgcacgcacgcgccgcgaccgagccggagacgatcgtcatcggc
ctgtcgggcaacggcatcctcgacctgcccgcgtaccaccagtacctctga

DBGET integrated database retrieval system