KEGG   Cellulomonas fimi: Celf_1658Help
Entry
Celf_1658         CDS       T01490                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00260  Glycine, serine and threonine metabolism
cfi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01130  Biosynthesis of antibiotics
cfi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celf_1658
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celf_1658
Enzymes [BR:cfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celf_1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEE45790
JGI: Celf_1658
UniProt: F4H7V6
Position
complement(1816637..1817947)
Genome map
AA seq 436 aa AA seqDB search
MTTTPDDVRPAPRTEPLGVTVPSTVPTHWYNLAADLPEPCPPALHPGTREPLTPDDLAPL
FPMALIAQEVSTERWVEIPQTVRELYALWRPSPLVRAVRLERALGTPARIYYKYEGVSPV
GSHKPNTAVAQAYYNAVEGITKLTTETGAGQWGASLSMACALLGLRCEVWQVRASYDSKP
YRRMQMETYGGVCHSSPSELTAAGRAILASDPETTGSLGMAISEAVEAAATDPAAHYALG
SVLNHVLLHQSVIGQEALAQLDEIGEGADVVFGCAGGGSNLGGLAFPFLGRNLREGTTTR
VVACEPAACPSMTQGEYRYDFGDVAGLTPLLKMHTLGKDFVPPPIHAGGLRYHGMAPMVS
HAYELGLMSAIAVEQGDAFAAGIEFARAEGIIPAPESTHAVAGAIAHARAATEPETIVIG
LSGNGILDLPAYHQYL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgcccgacgacgtgcgccccgccccccggaccgagcccctgggcgtcacc
gtcccctcgacggtcccgacgcactggtacaacctcgcggccgacctgcccgagccgtgc
ccgcccgcgctgcaccccggcacgcgcgagccgctcacccccgacgacctcgccccgctc
ttcccgatggcgctcatcgcgcaggaggtgagcaccgagcgctgggtcgagatcccgcag
acggtgcgcgagctgtacgcgctgtggcggccgtcgccgctcgtgcgcgcggtgcggctc
gagcgcgcgctgggcacgccggcgcgcatctactacaagtacgagggcgtgagcccggtc
ggctcgcacaagccgaacacggctgtcgcgcaggcgtactacaacgcggtcgaaggcatc
acgaagctcaccaccgagaccggcgccgggcagtggggcgcgtcgctgtcgatggcgtgc
gcgctgctcgggctgcggtgcgaggtgtggcaggtgcgcgcgtcctacgactccaagccg
taccggcgcatgcagatggagacgtacggcggcgtgtgccactcctcgccgtcggagctc
accgccgcgggccgggccatcctcgcgtccgacccggagacgaccgggtcgctcggcatg
gcgatcagcgaggccgtcgaggccgccgcgaccgaccccgccgcgcactacgcgctcggc
tccgtgctcaaccacgtgctcctgcaccagtccgtcatcgggcaggaggcgctcgcgcag
ctcgacgagatcggcgagggcgccgacgtcgtgttcggctgcgcgggcggcgggtccaac
ctcggcgggctcgcgttcccgttcctcggccgcaacctgcgcgaggggacgacgacgcgc
gtcgtcgcgtgcgagccggccgcgtgcccgtcgatgacgcagggcgagtaccggtacgac
ttcggcgacgtggcgggcctgaccccgctgctcaagatgcacacgctcggaaaggacttc
gtgccgccgcccatccacgcgggcggcctgcgctaccacggcatggcgccgatggtgtcg
cacgcctacgagctcgggctcatgagcgcgatcgccgtcgagcagggggacgccttcgcc
gcgggcatcgagttcgcccgcgccgaggggatcatccccgcgcccgagtcgacgcacgcc
gtcgccggggccatcgcgcacgcacgcgccgcgaccgagccggagacgatcgtcatcggc
ctgtcgggcaacggcatcctcgacctgcccgcgtaccaccagtacctctga

DBGET integrated database retrieval system