KEGG   Cellulomonas fimi: Celf_1658Help
Entry
Celf_1658         CDS       T01490                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cfi  Cellulomonas fimi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celf_1658
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celf_1658
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celf_1658
Enzymes [BR:cfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celf_1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1816637..1817947)
Genome map
AA seq 436 aa AA seqDB search
MTTTPDDVRPAPRTEPLGVTVPSTVPTHWYNLAADLPEPCPPALHPGTREPLTPDDLAPL
FPMALIAQEVSTERWVEIPQTVRELYALWRPSPLVRAVRLERALGTPARIYYKYEGVSPV
GSHKPNTAVAQAYYNAVEGITKLTTETGAGQWGASLSMACALLGLRCEVWQVRASYDSKP
YRRMQMETYGGVCHSSPSELTAAGRAILASDPETTGSLGMAISEAVEAAATDPAAHYALG
SVLNHVLLHQSVIGQEALAQLDEIGEGADVVFGCAGGGSNLGGLAFPFLGRNLREGTTTR
VVACEPAACPSMTQGEYRYDFGDVAGLTPLLKMHTLGKDFVPPPIHAGGLRYHGMAPMVS
HAYELGLMSAIAVEQGDAFAAGIEFARAEGIIPAPESTHAVAGAIAHARAATEPETIVIG
LSGNGILDLPAYHQYL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgcccgacgacgtgcgccccgccccccggaccgagcccctgggcgtcacc
gtcccctcgacggtcccgacgcactggtacaacctcgcggccgacctgcccgagccgtgc
ccgcccgcgctgcaccccggcacgcgcgagccgctcacccccgacgacctcgccccgctc
ttcccgatggcgctcatcgcgcaggaggtgagcaccgagcgctgggtcgagatcccgcag
acggtgcgcgagctgtacgcgctgtggcggccgtcgccgctcgtgcgcgcggtgcggctc
gagcgcgcgctgggcacgccggcgcgcatctactacaagtacgagggcgtgagcccggtc
ggctcgcacaagccgaacacggctgtcgcgcaggcgtactacaacgcggtcgaaggcatc
acgaagctcaccaccgagaccggcgccgggcagtggggcgcgtcgctgtcgatggcgtgc
gcgctgctcgggctgcggtgcgaggtgtggcaggtgcgcgcgtcctacgactccaagccg
taccggcgcatgcagatggagacgtacggcggcgtgtgccactcctcgccgtcggagctc
accgccgcgggccgggccatcctcgcgtccgacccggagacgaccgggtcgctcggcatg
gcgatcagcgaggccgtcgaggccgccgcgaccgaccccgccgcgcactacgcgctcggc
tccgtgctcaaccacgtgctcctgcaccagtccgtcatcgggcaggaggcgctcgcgcag
ctcgacgagatcggcgagggcgccgacgtcgtgttcggctgcgcgggcggcgggtccaac
ctcggcgggctcgcgttcccgttcctcggccgcaacctgcgcgaggggacgacgacgcgc
gtcgtcgcgtgcgagccggccgcgtgcccgtcgatgacgcagggcgagtaccggtacgac
ttcggcgacgtggcgggcctgaccccgctgctcaagatgcacacgctcggaaaggacttc
gtgccgccgcccatccacgcgggcggcctgcgctaccacggcatggcgccgatggtgtcg
cacgcctacgagctcgggctcatgagcgcgatcgccgtcgagcagggggacgccttcgcc
gcgggcatcgagttcgcccgcgccgaggggatcatccccgcgcccgagtcgacgcacgcc
gtcgccggggccatcgcgcacgcacgcgccgcgaccgagccggagacgatcgtcatcggc
ctgtcgggcaacggcatcctcgacctgcccgcgtaccaccagtacctctga

DBGET integrated database retrieval system