KEGG   Cellulomonas fimi: Celf_1807Help
Entry
Celf_1807         CDS       T01490                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01130  Biosynthesis of antibiotics
cfi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celf_1807
Enzymes [BR:cfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Celf_1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh DUF3509 DHO_dh
Motif
Other DBs
NCBI-ProteinID: AEE45937
JGI: Celf_1807
UniProt: F4GYE8
Position
1995755..1996567
Genome map
AA seq 270 aa AA seqDB search
MTVLDDIVAGVREDLAVREAAVPLAVVKELAAKRPSAVDCIGRLRVEDAVTVIAEVKRSS
PSKGALATITDPAALAAEYEKGGATAISVLTEQRRFNGSLADLDAVRARVDIPVLRKDFV
VTPYQVWEARAHGADLVLLIVAALEQTVLESLVDRVHSLGMTALVEVHDSEEAARAADAG
ARVIGVNARNLKTLDVDRTTFARVAPSIPSDVVKIAESGVRGPHDVMDYARAGADCVLVG
EALVTDDAPRQSVADLVAAGAHPSLRAVRQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgctggacgacatcgtcgcgggcgtcagggaggaccttgccgtccgcgaggcg
gcggtcccgctggccgtcgtcaaggagctcgccgccaagcggccgtcggcggtcgactgc
atcggccgcctgcgcgtcgaggacgcggtcacggtgatcgccgaggtcaagcgttcgagc
cccagcaagggcgcgctcgcgacgatcacggacccggccgcgctcgccgcggagtacgag
aagggcggcgccaccgcgatctcggtgctcaccgagcagcgccggttcaacggctcgctc
gccgacctcgacgcggtccgcgcgcgcgtcgacatcccggtgctgcgcaaggacttcgtc
gtcacgccgtaccaggtgtgggaggcgcgggcgcacggcgccgacctcgtgctgctcatc
gtcgcggcgctcgagcagacggtgctcgagtcgctcgtcgaccgcgtgcactcgctcggc
atgacggcgctagtcgaggtgcacgacagcgaggaggccgcgcgggccgccgacgcgggt
gcgcgcgtgatcggcgtgaacgcccgcaacctcaagacgctcgacgtcgaccgcacgacg
ttcgcccgggtcgcgccctcgatcccgtccgacgtggtgaagatcgccgagtccggcgtg
cgcgggccgcacgacgtcatggactacgcgcgcgccggtgcggactgcgtgctcgtcggc
gaggcgctcgtgaccgacgacgccccccggcagtcggtcgcggacctcgtcgccgcgggc
gcccacccctcgctgcgggcggtgcggcagtga

DBGET integrated database retrieval system