KEGG   Cellulomonas fimi: Celf_1808Help
Entry
Celf_1808         CDS       T01490                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00260  Glycine, serine and threonine metabolism
cfi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01130  Biosynthesis of antibiotics
cfi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celf_1808
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celf_1808
Enzymes [BR:cfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celf_1808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEE45938
JGI: Celf_1808
UniProt: F4GYE9
Position
1996564..1997880
Genome map
AA seq 438 aa AA seqDB search
MTARRGAGPTGAPLDPGAAAGPLATHAGPYFGDFGGRFVPEALIAALDELDTEYHKALTD
PAFGRELARLHRTYTGRPSPLTEVPRFARHVADGVRVFLKREDLNHTGSHKINNVLGQAL
LVKRMGKTRVIAETGAGQHGVATATAAALLDLECVVYMGEEDTQRQALNVARMRLLGAEV
VPVTIGSRTLKDAINEALRDWVANVETTHYLLGTVTGPHPFPEMVRDFHKIIGEEARAQL
LEEVGRLPDAVAACVGGGSNAMGIFNAFLDDADVRLFGFEAGGAGISSGRHAARFSGGLP
GVLHGAKSYLLQDEDGQTLPSHSVSAGLDYPSVGPEHAWLHDIGRAQYRPVTDDEAMEAF
RLLCRTEGIIPAIESAHALAGAISLGREAATWRGDDGHDPVLLINLSGRGDKDVATAAAW
FGLIEDEPVVLADENEQL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcacgtcgcggcgccggcccgaccggtgcgccgctcgaccccggtgcggcggcg
ggtccgctcgccacgcacgccggcccgtacttcggcgacttcggcggccgcttcgtcccc
gaggcgttgatcgcggcgctcgacgagctcgacaccgagtaccacaaggcgctcaccgac
ccggcgttcggccgcgagctcgcgcgtctgcaccgcacgtacaccggtcggccgagcccg
ctgacggaggtgccgcggttcgcccggcacgtcgccgacggggtgcgcgtgttcctcaag
cgcgaggacctcaaccacaccggctcgcacaagatcaacaacgtgctgggccaggcgctg
ctcgtgaagcgcatgggcaagacgcgcgtcatcgccgagacgggcgcgggccagcacggc
gtcgcgaccgcgacggcagcggcgctgctcgacctcgagtgcgtcgtctacatgggggag
gaggacacgcagcgccaggccctcaacgtcgcgcgcatgcggctcctcggcgccgaggtc
gtcccggtgacgatcggctcgcgcaccctcaaggacgcgatcaacgaggcgctgcgcgac
tgggtcgcgaacgtcgagacgacgcactacctgctcggcacggtcacgggcccgcacccc
ttcccggagatggtccgcgacttccacaagatcatcggcgaggaggcccgcgctcagctc
ctcgaggaggtcggccggctgcccgacgcggtcgcggcgtgcgtcggcggcggctccaac
gcgatgggcatcttcaacgcgttcctcgacgacgccgacgtgcgcctgttcggcttcgag
gccggcggtgcgggcatctcgagcggccgccacgcggcgcggttctcgggcggtctgccg
ggcgtgctgcacggcgccaagtcgtacctgctgcaggacgaggacggccagacgctgccg
agccactcggtctcggccgggctggactacccgagcgtcggccccgagcacgcgtggctg
cacgacatcggccgcgcgcagtaccggccggtgacggacgacgaggcgatggaggcgttc
cgcctgctgtgccggaccgaggggatcatcccggcgatcgagtcggcgcacgcgctcgcc
ggagcgatcagcctgggccgcgaggcggcgacgtggcgcggggacgacggccacgacccg
gtgctcctgatcaacctgtcgggccgcggcgacaaggacgtggcgaccgccgcggcgtgg
ttcggcctcatcgaggacgagccggtcgtgctggccgacgagaacgagcagctgtga

DBGET integrated database retrieval system