KEGG   Cellulomonas fimi: Celf_1808Help
Entry
Celf_1808         CDS       T01490                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cfi  Cellulomonas fimi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celf_1808
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celf_1808
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celf_1808
Enzymes [BR:cfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celf_1808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1996564..1997880
Genome map
AA seq 438 aa AA seqDB search
MTARRGAGPTGAPLDPGAAAGPLATHAGPYFGDFGGRFVPEALIAALDELDTEYHKALTD
PAFGRELARLHRTYTGRPSPLTEVPRFARHVADGVRVFLKREDLNHTGSHKINNVLGQAL
LVKRMGKTRVIAETGAGQHGVATATAAALLDLECVVYMGEEDTQRQALNVARMRLLGAEV
VPVTIGSRTLKDAINEALRDWVANVETTHYLLGTVTGPHPFPEMVRDFHKIIGEEARAQL
LEEVGRLPDAVAACVGGGSNAMGIFNAFLDDADVRLFGFEAGGAGISSGRHAARFSGGLP
GVLHGAKSYLLQDEDGQTLPSHSVSAGLDYPSVGPEHAWLHDIGRAQYRPVTDDEAMEAF
RLLCRTEGIIPAIESAHALAGAISLGREAATWRGDDGHDPVLLINLSGRGDKDVATAAAW
FGLIEDEPVVLADENEQL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcacgtcgcggcgccggcccgaccggtgcgccgctcgaccccggtgcggcggcg
ggtccgctcgccacgcacgccggcccgtacttcggcgacttcggcggccgcttcgtcccc
gaggcgttgatcgcggcgctcgacgagctcgacaccgagtaccacaaggcgctcaccgac
ccggcgttcggccgcgagctcgcgcgtctgcaccgcacgtacaccggtcggccgagcccg
ctgacggaggtgccgcggttcgcccggcacgtcgccgacggggtgcgcgtgttcctcaag
cgcgaggacctcaaccacaccggctcgcacaagatcaacaacgtgctgggccaggcgctg
ctcgtgaagcgcatgggcaagacgcgcgtcatcgccgagacgggcgcgggccagcacggc
gtcgcgaccgcgacggcagcggcgctgctcgacctcgagtgcgtcgtctacatgggggag
gaggacacgcagcgccaggccctcaacgtcgcgcgcatgcggctcctcggcgccgaggtc
gtcccggtgacgatcggctcgcgcaccctcaaggacgcgatcaacgaggcgctgcgcgac
tgggtcgcgaacgtcgagacgacgcactacctgctcggcacggtcacgggcccgcacccc
ttcccggagatggtccgcgacttccacaagatcatcggcgaggaggcccgcgctcagctc
ctcgaggaggtcggccggctgcccgacgcggtcgcggcgtgcgtcggcggcggctccaac
gcgatgggcatcttcaacgcgttcctcgacgacgccgacgtgcgcctgttcggcttcgag
gccggcggtgcgggcatctcgagcggccgccacgcggcgcggttctcgggcggtctgccg
ggcgtgctgcacggcgccaagtcgtacctgctgcaggacgaggacggccagacgctgccg
agccactcggtctcggccgggctggactacccgagcgtcggccccgagcacgcgtggctg
cacgacatcggccgcgcgcagtaccggccggtgacggacgacgaggcgatggaggcgttc
cgcctgctgtgccggaccgaggggatcatcccggcgatcgagtcggcgcacgcgctcgcc
ggagcgatcagcctgggccgcgaggcggcgacgtggcgcggggacgacggccacgacccg
gtgctcctgatcaacctgtcgggccgcggcgacaaggacgtggcgaccgccgcggcgtgg
ttcggcctcatcgaggacgagccggtcgtgctggccgacgagaacgagcagctgtga

DBGET integrated database retrieval system