KEGG   Cellulomonas fimi: Celf_1808Help
Entry
Celf_1808         CDS       T01490                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cfi  Cellulomonas fimi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cfi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cfi00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cfi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1996564..1997880
Genome map
AA seq 438 aa AA seqDB search
MTARRGAGPTGAPLDPGAAAGPLATHAGPYFGDFGGRFVPEALIAALDELDTEYHKALTD
PAFGRELARLHRTYTGRPSPLTEVPRFARHVADGVRVFLKREDLNHTGSHKINNVLGQAL
LVKRMGKTRVIAETGAGQHGVATATAAALLDLECVVYMGEEDTQRQALNVARMRLLGAEV
VPVTIGSRTLKDAINEALRDWVANVETTHYLLGTVTGPHPFPEMVRDFHKIIGEEARAQL
LEEVGRLPDAVAACVGGGSNAMGIFNAFLDDADVRLFGFEAGGAGISSGRHAARFSGGLP
GVLHGAKSYLLQDEDGQTLPSHSVSAGLDYPSVGPEHAWLHDIGRAQYRPVTDDEAMEAF
RLLCRTEGIIPAIESAHALAGAISLGREAATWRGDDGHDPVLLINLSGRGDKDVATAAAW
FGLIEDEPVVLADENEQL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcacgtcgcggcgccggcccgaccggtgcgccgctcgaccccggtgcggcggcg
ggtccgctcgccacgcacgccggcccgtacttcggcgacttcggcggccgcttcgtcccc
gaggcgttgatcgcggcgctcgacgagctcgacaccgagtaccacaaggcgctcaccgac
ccggcgttcggccgcgagctcgcgcgtctgcaccgcacgtacaccggtcggccgagcccg
ctgacggaggtgccgcggttcgcccggcacgtcgccgacggggtgcgcgtgttcctcaag
cgcgaggacctcaaccacaccggctcgcacaagatcaacaacgtgctgggccaggcgctg
ctcgtgaagcgcatgggcaagacgcgcgtcatcgccgagacgggcgcgggccagcacggc
gtcgcgaccgcgacggcagcggcgctgctcgacctcgagtgcgtcgtctacatgggggag
gaggacacgcagcgccaggccctcaacgtcgcgcgcatgcggctcctcggcgccgaggtc
gtcccggtgacgatcggctcgcgcaccctcaaggacgcgatcaacgaggcgctgcgcgac
tgggtcgcgaacgtcgagacgacgcactacctgctcggcacggtcacgggcccgcacccc
ttcccggagatggtccgcgacttccacaagatcatcggcgaggaggcccgcgctcagctc
ctcgaggaggtcggccggctgcccgacgcggtcgcggcgtgcgtcggcggcggctccaac
gcgatgggcatcttcaacgcgttcctcgacgacgccgacgtgcgcctgttcggcttcgag
gccggcggtgcgggcatctcgagcggccgccacgcggcgcggttctcgggcggtctgccg
ggcgtgctgcacggcgccaagtcgtacctgctgcaggacgaggacggccagacgctgccg
agccactcggtctcggccgggctggactacccgagcgtcggccccgagcacgcgtggctg
cacgacatcggccgcgcgcagtaccggccggtgacggacgacgaggcgatggaggcgttc
cgcctgctgtgccggaccgaggggatcatcccggcgatcgagtcggcgcacgcgctcgcc
ggagcgatcagcctgggccgcgaggcggcgacgtggcgcggggacgacggccacgacccg
gtgctcctgatcaacctgtcgggccgcggcgacaaggacgtggcgaccgccgcggcgtgg
ttcggcctcatcgaggacgagccggtcgtgctggccgacgagaacgagcagctgtga

DBGET integrated database retrieval system