KEGG   Cellulomonas fimi: Celf_1809Help
Entry
Celf_1809         CDS       T01490                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cfi  Cellulomonas fimi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celf_1809
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celf_1809
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celf_1809
Enzymes [BR:cfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celf_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1997892..1998737
Genome map
AA seq 281 aa AA seqDB search
MGTVDVRTATGEHLDRLRDGDGATPGRAALVGYLPVGYPSLAGSVDAVNAMVDAGADVVE
LGVPYTDPVMDGPIIQRAVDAALAGGTRVRDTLTAVERVAGRGAPVLVMTYWNVVLRYGV
EAFARDLAAAGGAGLITPDLIPDEAQDWVLASDTHGLDRVFLVAPSSTPERLASTSAASR
GFVYAASTMGVTGERASVGARAEQLVADTRAAGAPRVCVGVGVSTAEQAAQVAAYADGVI
VGSAFVRPLVAGVDADDLPRGIDALARVTADLAAGVRSVVR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgggcacggtggacgtccggacggcgacgggggagcacctcgaccgcctgcgagacggg
gacggcgcgacgccgggccgggcggcgctcgtcgggtacctgcccgtcggctacccgagc
ctcgccggttcggtggacgcggtgaacgcgatggtcgacgcgggcgccgacgtcgtcgag
ctcggcgtcccgtacacggaccccgtcatggacggtccgatcatccagcgcgccgtggac
gcggccctcgcgggcggcacacgcgtgcgggacaccctcacggcggtcgagcgggtcgcc
ggccgcggtgcgccggtgctggtcatgacgtactggaacgtcgtgctgcgctacggcgtc
gaggcgttcgcccgtgacctcgcggccgcgggcggggccgggctcatcacgcccgacctc
atccccgacgaggcgcaggactgggtcctcgcgtcggacacccacggtctcgaccgcgtg
ttcctcgtcgctcccagctcgacgcccgagcggctggcgtcgacgagcgccgcgtcgcgc
gggttcgtctacgcggcctcgacgatgggcgtgacgggcgagcgcgcgagcgtcggcgcg
cgcgccgagcagctcgtcgccgacacccgtgccgccggcgcgccgcgcgtctgcgtcggg
gtcggggtgtcgaccgcggagcaggcggcgcaggtcgcggcctacgccgacggcgtcatc
gtcgggtcggcgttcgtccgcccgctcgtcgcgggcgtcgacgcggacgacctgccgcgt
ggcatcgacgcgctcgcgcgcgtcacggccgacctcgccgcaggtgtgcggtcggtcgtg
cggtga

DBGET integrated database retrieval system