KEGG   Cellulomonas fimi: Celf_1847Help
Entry
Celf_1847         CDS       T01490                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cfi  Cellulomonas fimi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celf_1847
   01230 Biosynthesis of amino acids
    Celf_1847
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celf_1847
   00030 Pentose phosphate pathway
    Celf_1847
   00051 Fructose and mannose metabolism
    Celf_1847
   00052 Galactose metabolism
    Celf_1847
  Energy metabolism
   00680 Methane metabolism
    Celf_1847
Enzymes [BR:cfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Celf_1847
Protein phosphatases and associated proteins [BR:cfi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Celf_1847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2041339..2042364
Genome map
AA seq 341 aa AA seqDB search
MRVGLLTGGGDVPGLNAAIRAVVKHGEGQYGHSIIGFRNGWKGVVDGLSMPLTRQHIRNV
LPVGGTLLGTARFHPHAGDGGIDQVLATLEAERIEALICIGGDGTLHAASKVAEAGVKIV
AIPKTIDNDVWGTDQSIGFDTAVTIATDAIDRIHTTAESHNRVMVVEVMGRHAGWIAATA
GIAGGAELVLAPEAPFDIDRIERFLKHRHRAHASFSIVVVAEGAVPAEGTSMHYETQVGK
FGEIVAGAIGERLKAEIEQRTGFDTRVTVLGHVQRGGTPSPTDRILGSRFGVAAIDAITQ
GRSNVMTALRGERVELVPLSEVAGKVKHVPDELLSVARALA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgtcggtctgctcaccggaggcggcgacgtccccggcctcaacgcggcgatccga
gccgtcgtcaagcacggcgaggggcagtacggccactcgatcatcggcttccgcaacggc
tggaagggcgtcgtcgacggcctgtcgatgccgctgacgcgccagcacatccgcaacgtc
ctgcccgtcggcggcacgctgctgggcacggcacggttccacccgcacgcgggcgacggc
ggcatcgaccaggtgctcgcgacgctcgaggccgagcgcatcgaggcgctcatctgcatc
ggcggcgacggcacgctgcacgccgcgagcaaggtcgccgaggcgggcgtgaagatcgtg
gcgatccccaagaccatcgacaacgacgtgtggggcaccgaccagtcgatcggcttcgac
acggccgtcacgatcgcgaccgacgcgatcgaccgcatccacaccaccgcggagagccac
aaccgcgtcatggtcgtcgaggtcatgggccggcacgccggctggatcgcggcgaccgcg
ggcatcgcgggcggcgccgagctggtcctcgcgcccgaggcgccgttcgacatcgaccgc
atcgagcggttcctcaagcaccgccaccgcgcgcacgcgagcttctccatcgtcgtggtc
gccgagggcgcggtgcccgccgagggcacgtcgatgcactacgagacgcaggtcgggaag
ttcggcgagatcgtcgcaggggcgatcggcgagcggctcaaggccgagatcgagcagcgc
acgggcttcgacacgcgcgtcacggtcctcgggcacgtccagcgcggcgggaccccgtcg
ccgaccgaccgcatcctcggctcgcgcttcggcgtcgcggcgatcgacgcgatcacccag
ggccgctcgaacgtcatgaccgcgctgcgcggcgagcgtgtcgagctcgtgccgctgagc
gaggtcgccggcaaggtcaagcacgtccccgacgagctgctgtcggtcgcgcgggccctc
gcctga

DBGET integrated database retrieval system