KEGG   Cellulomonas fimi: Celf_1866Help
Entry
Celf_1866         CDS       T01490                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00010  Glycolysis / Gluconeogenesis
cfi00051  Fructose and mannose metabolism
cfi00562  Inositol phosphate metabolism
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01120  Microbial metabolism in diverse environments
cfi01130  Biosynthesis of antibiotics
cfi01200  Carbon metabolism
cfi01230  Biosynthesis of amino acids
Module
cfi_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celf_1866
   00051 Fructose and mannose metabolism
    Celf_1866
   00562 Inositol phosphate metabolism
    Celf_1866
Enzymes [BR:cfi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Celf_1866
Exosome [BR:cfi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Celf_1866
  Exosomal proteins of bladder cancer cells
   Celf_1866
  Exosomal proteins of melanoma cells
   Celf_1866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEE45996
JGI: Celf_1866
UniProt: F4GZ06
Position
2065897..2066691
Genome map
AA seq 264 aa AA seqDB search
MAQRTPLMAGNWKMNLDHHQATHTLQKLAWTLKDAKHDYAAVEVAVIPPFTDLRSVQTLV
DADKLEIVYGAQDLSAHESGAYTGEISPLFLAKLGVTYALVGHSERREYHAESDELINAK
VHSAFKAGLVPILCIGELLETRKAGEHVAHTLAQLDAALQGLTAEQVRTLVVAYEPVWAI
GTGETATPEDAQEMSAAIRGRLAELYDAETADAVRVLYGGSVKSSNVASIMAKPDVDGAL
VGGASLDPEEFAKIARFQAHEVGL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcgcaccccgctcatggcgggcaactggaagatgaacctggaccaccaccag
gccacgcacacgctgcagaagctcgcgtggaccctcaaggacgcgaagcacgactacgcg
gccgtcgaggtcgccgtgatcccgccgttcacggacctgcgcagcgtgcagacgctcgtg
gacgccgacaagctcgagatcgtctacggcgcgcaggacctgtcggcgcacgagtccggt
gcgtacacgggcgagatctcgccgctgttcctcgccaagctcggcgtgacctacgcgctc
gtcggccactcggagcggcgcgagtaccacgccgagtccgacgagctgatcaacgcgaag
gtccactcggcgttcaaggccggcctcgtgccgatcctgtgcatcggcgagctcctcgag
acccgcaaggcgggcgagcacgtcgcgcacacgctcgcgcagctcgacgccgccctgcag
ggcctcaccgccgagcaggtgcgtaccctcgtcgtcgcctacgagcccgtctgggcgatc
ggcacgggcgagacggccacgccggaggacgcccaggagatgtccgcggcgatccgcggg
cgcctcgcggagctgtacgacgccgagacggccgacgccgtgcgcgtgctgtacggcggc
tccgtgaagtcgtcgaacgtggcctcgatcatggcgaagcccgacgtcgacggcgcgctc
gtcggcggcgcgagcctcgaccccgaggagttcgccaagatcgcgcgcttccaggcgcac
gaggtcggtctctga

DBGET integrated database retrieval system