KEGG   Cellulomonas fimi: Celf_1866Help
Entry
Celf_1866         CDS       T01490                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cfi  Cellulomonas fimi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celf_1866
   01230 Biosynthesis of amino acids
    Celf_1866
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celf_1866
   00051 Fructose and mannose metabolism
    Celf_1866
   00562 Inositol phosphate metabolism
    Celf_1866
Enzymes [BR:cfi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Celf_1866
Exosome [BR:cfi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Celf_1866
  Exosomal proteins of bladder cancer cells
   Celf_1866
  Exosomal proteins of melanoma cells
   Celf_1866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2065897..2066691
Genome map
AA seq 264 aa AA seqDB search
MAQRTPLMAGNWKMNLDHHQATHTLQKLAWTLKDAKHDYAAVEVAVIPPFTDLRSVQTLV
DADKLEIVYGAQDLSAHESGAYTGEISPLFLAKLGVTYALVGHSERREYHAESDELINAK
VHSAFKAGLVPILCIGELLETRKAGEHVAHTLAQLDAALQGLTAEQVRTLVVAYEPVWAI
GTGETATPEDAQEMSAAIRGRLAELYDAETADAVRVLYGGSVKSSNVASIMAKPDVDGAL
VGGASLDPEEFAKIARFQAHEVGL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcgcaccccgctcatggcgggcaactggaagatgaacctggaccaccaccag
gccacgcacacgctgcagaagctcgcgtggaccctcaaggacgcgaagcacgactacgcg
gccgtcgaggtcgccgtgatcccgccgttcacggacctgcgcagcgtgcagacgctcgtg
gacgccgacaagctcgagatcgtctacggcgcgcaggacctgtcggcgcacgagtccggt
gcgtacacgggcgagatctcgccgctgttcctcgccaagctcggcgtgacctacgcgctc
gtcggccactcggagcggcgcgagtaccacgccgagtccgacgagctgatcaacgcgaag
gtccactcggcgttcaaggccggcctcgtgccgatcctgtgcatcggcgagctcctcgag
acccgcaaggcgggcgagcacgtcgcgcacacgctcgcgcagctcgacgccgccctgcag
ggcctcaccgccgagcaggtgcgtaccctcgtcgtcgcctacgagcccgtctgggcgatc
ggcacgggcgagacggccacgccggaggacgcccaggagatgtccgcggcgatccgcggg
cgcctcgcggagctgtacgacgccgagacggccgacgccgtgcgcgtgctgtacggcggc
tccgtgaagtcgtcgaacgtggcctcgatcatggcgaagcccgacgtcgacggcgcgctc
gtcggcggcgcgagcctcgaccccgaggagttcgccaagatcgcgcgcttccaggcgcac
gaggtcggtctctga

DBGET integrated database retrieval system