KEGG   Cellulomonas fimi: Celf_2137Help
Entry
Celf_2137         CDS       T01490                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cfi  Cellulomonas fimi
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celf_2137
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Celf_2137
Enzymes [BR:cfi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Celf_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2372126..2373022
Genome map
AA seq 298 aa AA seqDB search
MPTTAPLGLLGVPSSVAAHAPGLERGPAALRRAGLVATLRAAGRDVVDHGDTAVARWRHD
PPGRTVPHDVHRVVEVLQEARAATRAVLDAGHVPVVVGGECTVTLAVLAAAVDAGRDLGL
VYVDGGQDLHVPTGPADEPIADSTGVAHLLDLPGVHPALAGFGPRRPLLTADRLAFVGQS
DDEEDVHGLVPSLRVRADAVTADPVAAAARALAVAGRDGYLVHLDVDVLDFFALPLADVP
TYGRGLVPATLGTLLAALVRSEGFAGLVVTEANPDRDADGEHLALLVRLIADALTTGR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccaccgcacccctcggcctcctcggcgtcccgtcgagcgtcgccgcgcacgcg
cccggtctcgagcgcggccccgcggccctgcgccgtgccgggctcgtcgcgacgctgcgc
gccgcgggtcgcgacgtcgtggaccacggcgacaccgcggtcgcccgctggcggcacgac
ccgccgggacgcaccgtcccgcacgacgtgcaccgcgtcgtcgaggtgctgcaggaggcg
cgcgccgcgacgcgggcggtgctcgacgcggggcacgtgccggtcgtcgtcgggggtgag
tgcacggtcacgctggcggtgctcgcggcggccgtcgacgccgggcgggacctcgggctc
gtgtacgtggacggtggccaggacctgcacgtcccgaccggccccgcggacgagccgatc
gcggactcgacgggtgtcgcgcacctgctcgacctgcccggcgtgcaccccgcgctcgcc
gggttcggcccgcgccgcccgctgctcaccgcggaccgcctcgcgttcgtcgggcagtcc
gacgacgaggaggacgtgcacgggctcgtgccgtccctgcgcgtccgggcggacgccgtc
accgcggacccggtcgcggcggccgcccgggcgctcgccgtcgcggggcgcgacgggtac
ctcgtgcacctcgacgtcgacgtgctcgacttcttcgcgttgccgctcgccgacgtcccc
acctacggccgtggcctcgtcccggccacgctcggcaccctgctcgcggccctcgtccgc
agcgaggggttcgcggggctcgtcgtgaccgaggcgaaccccgaccgggacgccgacggc
gagcacctcgcgctgctcgtccggctgatcgccgacgccctcaccaccggccgctga

DBGET integrated database retrieval system