KEGG   Cellulomonas fimi: Celf_2153Help
Entry
Celf_2153         CDS       T01490                                 

Definition
Thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
cfi  Cellulomonas fimi
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Celf_2153
Enzymes [BR:cfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Celf_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2387104..2387775)
Genome map
AA seq 223 aa AA seqDB search
MAELVFFSGTMDCGKSTLALQMHHNHAARGRDGVLFTRNDRAGAATISSRLGLVQQAAEV
GDRTDFWSEVIERRTHGRPVDYLIGDEAQFYTAAQVEQLARVVDELEVDVYAFGISTDFR
ARLFPGSARLVELADRVEILQVKALCWCGARATHNARTVGGVMVVEGAQVVVGDVEAGAD
EVGYEVLCRRHHMRRMTAATARAASPTAATLTTAVQGTLGVRA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtggcggagctcgtcttcttctcgggcacgatggactgcggcaagtccacgctcgcgctg
cagatgcaccacaaccacgccgcgcgcggccgcgacggcgtgctgttcacgcgcaacgac
cgggccggggcggcgacgatctcctcacggctcggcctcgtgcagcaggcggccgaggtc
ggcgaccggacggacttctggtccgaggtcatcgagcgccgcacgcacgggcgcccggtc
gactacctcatcggtgacgaggcgcagttctacaccgccgcgcaggtcgagcagctcgcg
cgcgtcgtcgacgagctcgaggtcgacgtgtacgcgttcggcatctcgaccgacttccgc
gcccgcctgttcccgggctcggcgcggctggtcgagctcgccgaccgggtcgagatcctg
caggtcaaggcgctgtgctggtgcggtgcccgcgccacgcacaacgcgcgcacggtcggc
ggcgtcatggtcgtcgagggtgcgcaggtggtcgtgggcgacgtcgaggccggtgccgac
gaggtcggctacgaggtgctgtgccgccggcaccacatgcgccgcatgaccgccgccacg
gcgcgcgcggcgtccccgacggccgcgaccctgacgacggccgtgcagggcacgctcggc
gtgcgcgcctga

DBGET integrated database retrieval system