KEGG   Cellulomonas fimi: Celf_2174Help
Entry
Celf_2174         CDS       T01490                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00010  Glycolysis / Gluconeogenesis
cfi00052  Galactose metabolism
cfi00500  Starch and sucrose metabolism
cfi00520  Amino sugar and nucleotide sugar metabolism
cfi00521  Streptomycin biosynthesis
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01120  Microbial metabolism in diverse environments
cfi01130  Biosynthesis of antibiotics
cfi01200  Carbon metabolism
Module
cfi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celf_2174
   00052 Galactose metabolism
    Celf_2174
   00500 Starch and sucrose metabolism
    Celf_2174
   00520 Amino sugar and nucleotide sugar metabolism
    Celf_2174
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Celf_2174
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Celf_2174
Enzymes [BR:cfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Celf_2174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Hydant_A_N BcrAD_BadFG DEDD_Tnp_IS110 FtsA FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEE46302
JGI: Celf_2174
UniProt: F4H1K3
Position
complement(2413460..2414401)
Genome map
AA seq 313 aa AA seqDB search
MHAIGVDIGGTKIAAGVVDEDGVILAQTRVETSPDDVAGIDRAIAQVYTELAGSYEVGAM
GLAAAGFVAADRSGVLFAPNIAWRDYPLRDRVKALIADDITVVVENDANAAGWAEFRFGA
ARDVDDMLMLTVGTGLGGAIVSNGELVRGAWGVASEVGHMRVVPGGHYCGCGHEGCWEQY
ASGSALVRDAQAAAITQPERALRLLELAGDVEKIVGPQITQAAEEGDPLAVELLAELGRW
LGEGAASATALLDPALIVVGGGVVAAGELLLGPARKGFAEQLSARGHRPEAVFVAAAMGN
DAGMVGAADLARI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccatcggtgtggacatcggcgggacgaagatcgcggccggcgtggtcgacgag
gacggcgtgatcctcgcccagacgcgggtggagacgtcgcccgacgacgtcgcggggatc
gaccgcgccatcgcccaggtgtacacggagctggccggctcctacgaggtcggcgcgatg
ggcctggccgccgcgggcttcgtcgccgcggaccgttcgggcgtgctgttcgcgcccaac
atcgcgtggcgcgactacccgctgcgcgaccgcgtcaaggcgctcatcgcggacgacatc
acggtcgtcgtggagaacgacgccaacgcggccggctgggcggagttccgcttcggcgcg
gcgcgcgacgtcgacgacatgctcatgctgaccgtcggcacgggcctgggcggtgcgatc
gtctcgaacggcgagctcgtccgcggcgcgtggggcgtcgcctccgaggtcggccacatg
cgcgtcgtgccgggcggccactactgcggctgcgggcacgagggctgctgggagcagtac
gcgtccggcagcgcgctcgtgcgcgacgcccaggccgccgcgatcacccagcccgagcgg
gccctgcgcctcctcgagctcgcgggggacgtcgagaagatcgtcggcccgcagatcacc
caggccgccgaggagggcgacccgctggcggtcgagctgctcgccgagctgggccggtgg
ctgggcgagggtgcggcgtccgcgaccgcgctgctcgacccggcgctcatcgtcgtgggc
ggcggcgtcgtcgcggccggcgagctgctgctcggcccggcccgcaagggcttcgcggag
cagctctcggcccgcggccaccgccccgaggccgtgttcgtcgcggcggcgatgggcaac
gacgccggcatggtcggcgctgcggacctcgcccgcatctga

DBGET integrated database retrieval system