KEGG   Cellulomonas fimi: Celf_2174Help
Entry
Celf_2174         CDS       T01490                                 

Definition
glucokinase, ROK family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cfi  Cellulomonas fimi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celf_2174
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celf_2174
   00052 Galactose metabolism
    Celf_2174
   00500 Starch and sucrose metabolism
    Celf_2174
   00520 Amino sugar and nucleotide sugar metabolism
    Celf_2174
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Celf_2174
   00524 Butirosin and neomycin biosynthesis
    Celf_2174
Enzymes [BR:cfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Celf_2174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2413460..2414401)
Genome map
AA seq 313 aa AA seqDB search
MHAIGVDIGGTKIAAGVVDEDGVILAQTRVETSPDDVAGIDRAIAQVYTELAGSYEVGAM
GLAAAGFVAADRSGVLFAPNIAWRDYPLRDRVKALIADDITVVVENDANAAGWAEFRFGA
ARDVDDMLMLTVGTGLGGAIVSNGELVRGAWGVASEVGHMRVVPGGHYCGCGHEGCWEQY
ASGSALVRDAQAAAITQPERALRLLELAGDVEKIVGPQITQAAEEGDPLAVELLAELGRW
LGEGAASATALLDPALIVVGGGVVAAGELLLGPARKGFAEQLSARGHRPEAVFVAAAMGN
DAGMVGAADLARI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccatcggtgtggacatcggcgggacgaagatcgcggccggcgtggtcgacgag
gacggcgtgatcctcgcccagacgcgggtggagacgtcgcccgacgacgtcgcggggatc
gaccgcgccatcgcccaggtgtacacggagctggccggctcctacgaggtcggcgcgatg
ggcctggccgccgcgggcttcgtcgccgcggaccgttcgggcgtgctgttcgcgcccaac
atcgcgtggcgcgactacccgctgcgcgaccgcgtcaaggcgctcatcgcggacgacatc
acggtcgtcgtggagaacgacgccaacgcggccggctgggcggagttccgcttcggcgcg
gcgcgcgacgtcgacgacatgctcatgctgaccgtcggcacgggcctgggcggtgcgatc
gtctcgaacggcgagctcgtccgcggcgcgtggggcgtcgcctccgaggtcggccacatg
cgcgtcgtgccgggcggccactactgcggctgcgggcacgagggctgctgggagcagtac
gcgtccggcagcgcgctcgtgcgcgacgcccaggccgccgcgatcacccagcccgagcgg
gccctgcgcctcctcgagctcgcgggggacgtcgagaagatcgtcggcccgcagatcacc
caggccgccgaggagggcgacccgctggcggtcgagctgctcgccgagctgggccggtgg
ctgggcgagggtgcggcgtccgcgaccgcgctgctcgacccggcgctcatcgtcgtgggc
ggcggcgtcgtcgcggccggcgagctgctgctcggcccggcccgcaagggcttcgcggag
cagctctcggcccgcggccaccgccccgaggccgtgttcgtcgcggcggcgatgggcaac
gacgccggcatggtcggcgctgcggacctcgcccgcatctga

DBGET integrated database retrieval system