KEGG   Cellulomonas fimi: Celf_2244Help
Entry
Celf_2244         CDS       T01490                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
cfi  Cellulomonas fimi
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celf_2244
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celf_2244
   00520 Amino sugar and nucleotide sugar metabolism
    Celf_2244
Enzymes [BR:cfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Celf_2244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2486753..2487523
Genome map
AA seq 256 aa AA seqDB search
MNHHHKKKHAVAFGIDIGGSGIKGAPVDLAAGEFSADRVRIPTPLPATPDAVSATVAEVV
ASFDLDTDVPIGVTFPAVILHGVAQSAANVDKSWIGTDVEAAVGAATGRRVVAVNDADAA
GYAEVRYGAAKDVDGVVLVVTLGTGIGSALVVDGRLVPNTELGHLEIDGFDAESRAADSA
RDREDLDWATWAQRLQRYFTVVENLFWPDLIVVGGGVSKHHQQFLPLLDLRTRIVPAELR
NAAGIVGAAALAARAH
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccaccacaagaagaagcacgcggtcgcgttcggcatcgacatcggcggcagc
ggcatcaagggcgcccccgtcgacctggccgccggggagttctccgccgaccgcgtccgc
atccccacgcccctgcccgccacgcccgacgcggtctccgcgaccgtcgccgaggtcgtc
gcgtcgttcgacctcgacacggacgtgccgatcggtgtcacgttccccgcggtgatcctg
cacggcgtcgcgcagtccgcggccaacgtcgacaagtcctggatcggcacggacgtcgag
gccgccgtcggcgccgcgaccggccgccgcgtggtcgccgtgaacgacgccgacgccgcc
ggctacgccgaggtgcggtacggcgcggccaaggacgtcgacggcgtcgtgctggtcgtg
acgctcggcaccgggatcggctccgcgctcgtcgtcgacgggcgtctcgtgccgaacacc
gagctcggccacctcgagatcgacgggttcgacgccgagtcgcgtgccgccgacagcgcc
cgcgaccgcgaggacctcgactgggcgacctgggcgcagcgcctgcagcgctacttcacc
gtggtcgagaacctgttctggcccgacctcatcgtggtcggcggcggcgtcagcaagcac
caccagcagttccttccgctgctggacctgcggacccgcatcgtcccggccgagctgcgc
aacgcggccggcatcgtcggcgcggcggcactcgccgccagggcccactga

DBGET integrated database retrieval system