KEGG   Cellulomonas fimi: Celf_2540Help
Entry
Celf_2540         CDS       T01490                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cfi  Cellulomonas fimi
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Celf_2540
Enzymes [BR:cfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Celf_2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2829592..2831526
Genome map
AA seq 644 aa AA seqDB search
MTVDAPAGDGRGTDPRVPWRVDGLLAPFVRAGALASADVHVARRLGAIAHETDERVHLAV
ALAVAAVRAGSVCVELADAPGAVAALLDGADPPRAADLPWPALDGPDGWVAAVRRSPLVG
DGLDGADDRPVRWVDGRVYLDRYWRDELSVRREVEARLARGAPAAPGAADDQADIDAAGG
DGPVDGSNCSDGAIDDVARRLFPAATDDRQREALRTASTSLLTVLTGGPGTGKTTTVARL
VAALQATAGPGLRVALAAPTGKAASRLQESVNAQVATLDEDDRARVGTLTATTLHRLLGP
RPGSTTRFRHDRDRRLPHDVVVVDESSMVSLPLMARLVEALRPDARLVLVGDPDQLASVE
AGAVLGDLVASLHGRAVVRLTQTHRFGDDLAALAAAVRAGDADATLALLRTGGAHVRLTA
TEVDAPAPDDLVGLRHDVVTAGRALVAAARAGDAAAALAALGQHRLLLAHREGPAGVARW
AAQAEAWVEAATDARDSREPWPLGLPLLVTENDPSSGLSNGDTGVVVRDLVGTGTRGPAA
HGPAPGDAVVVAFGDPDRPHLVRPHRLPAVQPVHAMTVHRGQGSQFTRVTVLLPPATSPL
LTRELLYTAVTRARESVHVIGSPDAVRAAVERPVRRASGLRHPL
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtcgacgcacctgccggggacgggcgaggcaccgatccccgcgtgccgtggcgt
gtcgacgggctgctcgccccgttcgtccgagcgggggcgctcgcgtcggcggacgtccat
gtggcgcgtcggctcggggcgatcgcgcacgagaccgacgagcgggtgcacctcgcggtc
gcgctcgcggtggcggccgtgcgggccgggtcggtctgcgtcgagctcgccgacgctccg
ggtgcggtcgccgcgctgctcgacggggccgatcccccgcgtgccgccgacctgccctgg
cccgcgctcgacggtcccgacggctgggtggccgccgtgcgccggagcccgctggtcggc
gacgggctcgacggtgccgacgaccggccggtccggtgggtggacggccgcgtctacctc
gaccggtactggcgcgacgagctgtcggtccgccgcgaggtcgaggcacgcctcgctcgc
ggggcaccggccgcacccggggccgcggacgaccaggccgacatcgacgcggcgggcggc
gacgggcccgtcgacggcagcaactgcagcgacggcgcgatcgacgacgtcgcacgcagg
ctgttccccgccgcgaccgacgaccggcagcgcgaggcgctgcggacggcgtcgacgtcg
ttgctgacggtcctgacgggcggccccggcacgggcaagaccacgacggtcgcgcggctc
gtcgccgcgctgcaggcgaccgccggaccgggcctgcgcgtcgcgctcgccgcgccgacc
ggaaaggccgcctcccggctccaggagtcggtcaacgcccaggtcgcgaccctcgacgag
gatgaccgggcgcgcgtcgggacgctcacggcgacgacgctgcaccggctgctggggcca
cgcccgggcagcacgacccgcttccggcacgaccgggaccgccgcctgccgcacgacgtc
gtcgtggtcgacgagtcctccatggtgtcgttgccgctcatggcccggctggtggaggcg
ctccggccggacgcccggctcgttctcgtcggtgaccccgaccagctcgccagcgtcgag
gcgggtgccgtgctgggcgacctcgtggcgtccctgcacgggcgcgcggtggtgcggctc
acccagacccaccggttcggcgacgaccttgccgcactcgcggcggcggtccgcgcgggc
gacgccgacgccacgctggccctcctgaggacgggcggtgcgcacgtccgtctcacggcc
acggaggtcgacgcgccggcgccggacgacctggtcggcctgcgccacgacgtcgtcacc
gccggtcgggcgctggtcgcggccgctcgtgccggcgacgcggccgccgcgctcgcggcg
ctcgggcagcaccggctgctgctcgcccaccgggagggcccggccggcgtggcccgctgg
gcggcccaggcggaggcgtgggtcgaggccgccacggacgcgcgcgactcccgggagccg
tggccgttggggctgcctctgctcgtcacggagaacgacccgtcgagcgggttgtccaac
ggcgacaccggggtcgtggtccgggacctggtcggcaccgggacccgtgggccggcggcg
cacggaccggcaccgggcgatgccgtcgtcgtggcgttcggcgatcccgatcgtccgcac
ctggtgcggccgcaccggctccccgccgtgcagccggtgcacgcgatgacggtgcaccgg
gggcagggcagccagttcacgcgcgtgaccgtcctgctgccgcccgcgacgtcgccgctg
ctgacccgcgagctgctctacaccgccgtgacgcgcgcccgcgagtccgtgcacgtgatc
ggctcgcccgacgccgtgcgggcagccgtcgagcgacccgtccgacgtgcgagcggccta
cggcacccgctgtga

DBGET integrated database retrieval system