KEGG   Cellulomonas fimi: Celf_2769Help
Entry
Celf_2769         CDS       T01490                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cfi  Cellulomonas fimi
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Celf_2769
  Lipid metabolism
   00561 Glycerolipid metabolism
    Celf_2769
   00600 Sphingolipid metabolism
    Celf_2769
Enzymes [BR:cfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Celf_2769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3079662..3081848)
Genome map
AA seq 728 aa AA seqDB search
MSTETRDDVVPTTPAPDLLHLRADGVSLVVDLDGGTLPRVLHWGADLGDVDEAVLRDLRL
ASRPMPIGFPVDGEVPVAVVPEQSAGFLGTPGLTGTRDGRDFSTAFVVRTHTLARLDDGT
QRLDVHADDTAAGLTLDLVLELTPHGLVRQRGTVTSTADGTYALDGLLLTLPVPAVATEL
LDFSGRWARERSPQRTAFTHGTRLRENRRGRTGYDTAFVLVAGTAGFGHRSGRVWGVHTA
WSGNHRNLAERSHYQPGLLGGGELLAAGEVRLATGESYTSPWVYGSTGEGLDALAGRFHR
WMRARPQHPRTPRPVTLNTWEAVYFQHDLGRLTELADAAAAIGAERFVLDDGWFGSRRDD
TRGLGDWYVSADVWPQGLHPLVDHVTGLGLQFGLWVEPEMVNPDSDLARAHPDWMLQVPS
RLPRPARHQQVLDLAQPGAYAYILDRLDALLTEYAIGYLKWDHNRDLVDAGHGPAGVAGV
HGQTLAVYRLLDELRSRHPGVEIESCSSGGGRVDLEILQRTDRIWGSDCIDALERQQIQR
WTNLLVPLEIVGSHIGSGTAHSTGRRHALSFRAGTALFGHLGIEWDLREADQDQRAELAA
WVAAYKDLRGLLHTGATVHADGVDPSHHVHGVVAQDGSDALFAVVATATSDALPTGRLTF
PGLDPDATYHVRPQPPGDVVDGLGSHWLSLPWWTPEGVRLTGRVLAEVGLQVPVLFPEHL
VLVRATRV
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccgagacgcgggacgacgtcgtccccaccacccccgcacccgacctgctgcac
ctgcgcgccgacggcgtgagcctcgtcgtcgacctggacggcggcaccctgccgcgcgtc
ctgcactggggagccgacctgggcgacgtcgacgaggccgtcctgcgcgacctgcggctc
gcgtcccgcccgatgccgatcggcttccccgtcgacggggaggtgcccgtcgcggtcgtc
cccgagcagtccgccggcttcctcggcacgccgggcctgaccgggacgcgcgacgggcgc
gacttctcgacggccttcgtcgtgcgcacgcacaccctcgcgcggctcgacgacgggacg
cagcgcctcgacgtgcacgccgacgacaccgccgccgggctcacgctggacctggtcctc
gagctcaccccgcacgggctcgtgcggcagcgcggcaccgtgacgagcaccgccgacggc
acgtacgcgctcgacgggctgctgctcacgctccccgtgccggccgtcgcgaccgagctc
ctcgacttctccggccgctgggcacgcgagcgcagcccgcagcggaccgccttcacccac
gggacccggctgcgggagaaccgccggggccgtaccggctacgacaccgcgttcgtcctc
gtcgccggcaccgccgggttcggccaccgcagcgggcgcgtctggggcgtgcacaccgcc
tggtcgggcaaccaccgcaacctcgcggagcgcagccactaccagccggggctgctcggg
ggcggggagctgctcgccgcgggcgaggtgcggctcgccacgggggagtcgtacacgagc
ccctgggtgtacgggtccacgggcgagggcctcgacgcgctcgcgggccggttccaccgc
tggatgcgggcgcggccgcagcacccgcgcacgccgcggcccgtcacgctcaacacctgg
gaggccgtgtacttccagcacgacctcgggcggctcaccgagctcgccgacgccgcggcg
gcgatcggggccgagcggttcgtgctcgacgacggctggttcggctcccgtcgcgacgac
acgcgcgggctgggggactggtacgtctcggccgacgtgtggccgcaggggctgcacccg
ctcgtcgaccacgtcaccggcctcgggctgcagttcggcctgtgggtcgagccggagatg
gtcaaccccgactccgacctcgcgcgcgcgcaccccgactggatgctccaggtgccgtcg
cggctgccgcggccggcccggcaccagcaggtgctcgacctcgcgcagccgggggcgtac
gcctacatcctcgaccggctcgacgcgctgctcaccgagtacgcgatcgggtacctcaag
tgggaccacaaccgcgacctcgtcgacgccgggcacgggcccgcgggcgtcgcgggggtg
cacgggcagacgctcgccgtctaccgcctgctcgacgagctccggtcgcggcaccccggg
gtcgagatcgagtcgtgctcgtcgggcggcggacgcgtcgacctggagatcctgcagcgg
acggaccggatctgggggagcgactgcatcgacgcgctcgagcggcagcagatccagcgg
tggaccaacctgctcgtgccgctggagatcgtcggctcgcacatcggctcgggcaccgcg
cacagcaccgggcggcggcacgccctgtcgttccgcgcgggcactgcgctgttcgggcac
ctcggcatcgagtgggacctgcgcgaggccgaccaggaccagcgtgccgagctcgcggcc
tgggtcgccgcgtacaaggacctgcgcgggctgctgcacaccggcgcgacggtgcacgcc
gacggggtcgacccgtcgcaccacgtgcacggcgtcgtcgcgcaggacgggtcggacgca
ctgttcgcggtcgtcgccaccgccacgtccgacgcccttccgacgggccggctgacgttc
cccgggctcgaccccgacgcgacctaccacgtgcgtccccagccgcccggcgacgtcgtc
gacgggctcgggagccactggctgtcgttgccgtggtggacacccgagggtgtgcggctc
accgggcgggtgctcgccgaggtcggtctgcaggtgcccgtgctcttccccgagcacctc
gtcctggtgcgcgcgacgcgcgtgtga

DBGET integrated database retrieval system