KEGG   Cellulomonas fimi: Celf_2785Help
Entry
Celf_2785         CDS       T01490                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Celf_2785
Enzymes [BR:cfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Celf_2785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_2_C Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: AEE46909
JGI: Celf_2785
UniProt: F4H7E8
Position
complement(3109031..3111049)
Genome map
AA seq 672 aa AA seqDB search
MSGLDTLTAPRGVLYGGDWNPEQWTPDVWREDVALMQAAGVNLVSVGIFSWATLEPEPGR
FELAWLDEVLDLLHGAGVAVDLATPCASPPPWLAHRFPETCAVDAQGVRMSVGSRNHFCP
GSQVYRDHVARVVQVLVDRYAEHPAVAMWHVGNEFGQTCWCDLCAQRLRTWLRDRYGDVD
ALNAAWATAFWSQRYSSFDEVVPPRTAPYLHNPAAELDFRRFTSDQLREVHREQVAIIRE
RSAAPVTTNFMNFFPGVDQHAWADDVDVVADDCYTDPADPASPARAALAHDLVRGVRRGE
PWLLMEQAAGAVNWRAHNVPKSTRTMVLDSLRAVAHGADGVCYFQWRASTGGAERFHSAM
VPHAGPDTDLHRAVRAQGALLQRLRPVAGTRVDARVALVFDWPAWWAGELLPARPSARLD
VLGQLAAYHEPLWRAGVATDVVPPSADLDRYDVVVVPSLHAVDDASAANVATVPARGGVL
LVGPFSGVADEHARVRRGRFPVPWTGVLGASGEDWRPLDDAGVTVASDRYGTFTATTWSE
HVRTDGAEVLATYADGDLAGHPALLRRRDPGGGEAWYVTTVPPRDVLAAVLADALAAAGV
AAPLVDLPEDVEAARRGDVLFLLNRSRSPRAVPLPAWAAGSTDLLTGDAVADELHLPAEG
AAALLAPTEETP
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggctcgacacgctgaccgccccgcgcggcgtgctctacggcggcgactggaac
cccgagcagtggacgcccgacgtgtggcgcgaggacgtcgcgctcatgcaggcggcgggg
gtcaacctcgtctcggtcggcatcttctcctgggccacgctcgagcccgagcccggccgg
ttcgagctcgcgtggctcgacgaggtgctcgacctcctgcacggcgcgggcgtcgccgtc
gacctcgccaccccgtgcgcgtccccgccgccgtggctcgcgcaccgcttccccgagacg
tgcgccgtcgacgcgcagggcgtccggatgtccgtcggctcgcgcaaccacttctgcccc
gggtcgcaggtgtaccgcgaccacgtcgcgcgtgtcgtgcaggtcctggtcgaccgctac
gccgagcaccccgcggtcgcgatgtggcacgtcggcaacgagttcggccagacgtgctgg
tgcgacctgtgcgcgcagcgcctgcggacctggctgcgcgaccgctacggcgacgtcgac
gcgctcaacgccgcgtgggccactgcgttctggagccagcggtactcgtccttcgacgag
gtcgtgccgccgcggaccgccccgtacctgcacaaccccgcggcggagctcgacttccgc
cggttcacctccgaccagctgcgcgaggtgcaccgcgagcaggtcgcgatcatccgggag
cgctcggcggcacccgtcacgacgaacttcatgaacttcttcccgggcgtcgaccagcac
gcgtgggccgacgacgtcgacgtcgtcgccgacgactgctacaccgaccccgcggacccc
gcctcgcccgcacgcgcggccctcgcgcacgacctggtgcgcggcgtccggcgcggcgag
ccgtggctgctcatggagcaggccgcgggcgcggtcaactggcgcgcgcacaacgtcccg
aagagcacccgcaccatggtgctcgactccctgcgggcggtcgcgcacggcgccgacggg
gtctgctacttccagtggcgtgcgtcgaccgggggcgccgagcgcttccactcggcgatg
gtcccgcacgccggcccggacaccgacctgcaccgtgcggtccgcgcgcagggcgcgctg
ctgcagcggctgcgcccggtagccggcacgcgcgtcgacgcgcgcgtcgcgctcgtcttc
gactggcccgcatggtgggcgggcgagctgctgccggcccggcccagcgcgcggctcgac
gtcctcgggcagctcgcggcgtaccacgagccgctgtggcgcgccggggtcgcgacggac
gtcgtgccgccgtcggcggacctggaccgctacgacgtcgtggtcgtgccgtcgctgcac
gcggtcgacgacgcgtccgccgcgaacgtggcgaccgtgcccgcgcgcggcggtgtcctg
ctcgtcggtccgttcagcggtgtcgccgacgagcacgcgcgcgtgcggcgcggccgcttc
ccggtgccgtggaccggcgtgctgggggcgtccggcgaggactggcgcccgctcgacgac
gcgggcgtcaccgtcgcgtccgaccggtacgggaccttcaccgcgacgacgtggtcggag
cacgtccgcaccgacggcgccgaggtgctcgcgacctacgcggacggcgacctcgcgggc
caccccgccctgctgcgccgccgcgaccccggtggcggcgaggcctggtacgtcacgacc
gtcccgccgcgcgacgtgctcgccgccgtgctggccgacgcgctcgccgccgccggcgtc
gcggcgccgctggtcgacctgcccgaggacgtcgaggccgcgcgccgcggcgacgtcctc
ttcctgctcaaccgctcccgctcgccccgcgccgtcccgctgcccgcctgggccgcgggg
tcgaccgacctgctcacgggcgacgcggtcgccgacgagctgcacctgcccgccgagggt
gccgcggccctgctggcaccgaccgaggagacaccatga

DBGET integrated database retrieval system