KEGG   Cellulomonas fimi: Celf_2830Help
Entry
Celf_2830         CDS       T01490                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00630  Glyoxylate and dicarboxylate metabolism
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01120  Microbial metabolism in diverse environments
cfi01200  Carbon metabolism
Module
cfi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Celf_2830
Enzymes [BR:cfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Celf_2830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEE46952
JGI: Celf_2830
UniProt: F4H7Z1
Position
3157580..3158905
Genome map
AA seq 441 aa AA seqDB search
MSTATDPTRTTPTLPGDRTQSAADLAAAWATDPRWSGLRRTHTAQDVVALRGSVGEEHTL
ARRGARRLWELLHQRTHVPALGALTGNQAVQQVRAGLEAIYLSGWQVAADANLSGQTYPD
QSLYPVNSVPAVVRRINNALLRADQVEVAEHGTASRDWLVPVVADAEAGFGGPLNAYELM
LAMITAGAAGVHWEDQLAAEKKCGHLGGKVLVPTSQHVRTLSAARLAADVADVPTVIVAR
TDALGADLLTSDADERDHPFLTGERTPEGYHRVRPGLDAVVARADAYAPFADLLWVETST
PDLALAIEFAERIHDKHPGKLLAYNCSPSFLWRKHLDDTQIARFQRELAGYGYAFQFVTL
AGFHALNHSMFDLARGYAERGMSAYVELQQAEIAAEAAGYTATRHQREVGTGYFDRVATA
ITPDASTLALAGSTETAQFTH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgccaccgacccgacccgcacgaccccgacgctgcccggcgaccgcacccag
agcgcggccgacctcgcggcggcctgggcgaccgacccgcgctggtccggcctccgccgg
acccacaccgcgcaggacgtcgtggcgctgcggggctcggtcggcgaggagcacaccctc
gcccggcggggagcgcggcggctgtgggagctgctgcaccagcgcacgcacgtgccggcg
ctcggtgcgctgacgggcaaccaggccgtgcagcaggtccgcgcggggctggaggcgatc
tacctgtccgggtggcaggtggccgccgacgcgaacctgtccggccagacgtacccggac
cagagcctgtacccggtcaactcggtgccggccgtcgtgcgtcgcatcaacaacgcgctg
ctgcgcgcggaccaggtcgaggtcgcggagcacggcacggcgtcgcgcgactggctggtc
cccgtcgtcgcggacgcggaggccgggttcggcggcccgctcaacgcctacgagctcatg
ctcgcgatgatcacggccggcgccgcgggcgtgcactgggaggaccagctcgcggcggag
aagaagtgcggccacctgggcggcaaggtcctcgtcccgaccagccagcacgtccgcacg
ctctcggcggcgcggctcgcggccgacgtggcggacgtcccgacggtgatcgtcgcgcgc
accgacgccctgggcgcggacctcctgacgagcgacgccgacgagcgcgaccacccgttc
ctcacgggcgagcgcacgcccgagggctaccaccgcgtgcggcccggtctcgacgcggtg
gtcgcccgcgccgacgcgtacgcgccgttcgcggacctgctgtgggtcgagacgtcgacg
cccgacctggcgctcgcgatcgagttcgcggagcggatccacgacaagcaccccggcaag
ctgctcgcgtacaactgctcgccgtcgttcctgtggcgcaagcacctcgacgacacgcag
atcgcgcggttccagcgcgagctcgccgggtacgggtacgcgttccagttcgtcacgctc
gcgggcttccacgcgctcaaccactcgatgttcgacctggcccggggctacgccgagcgc
ggcatgagtgcgtacgtcgagctccagcaggccgagatcgcggccgaggccgcgggctac
accgccacccgccaccagcgcgaggtcgggaccgggtacttcgaccgggtcgccaccgcg
atcacccccgacgcctcgaccctcgcgctcgccggctccaccgagacggcccagttcacc
cactga

DBGET integrated database retrieval system