KEGG   Cellulomonas fimi: Celf_2831Help
Entry
Celf_2831         CDS       T01490                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cfi  Cellulomonas fimi
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celf_2831
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Celf_2831
   00630 Glyoxylate and dicarboxylate metabolism
    Celf_2831
Enzymes [BR:cfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Celf_2831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3158955..3160622
Genome map
AA seq 555 aa AA seqDB search
MTVLTPAPGLTPSTGPFAQPFLDMVGPAVPGTDEVLTPEALDFVTDLHTLFGARRTTLLR
ERQLRRDRIANGTDPGFLPLTAGIRADRTWRVAGPGPGLEDRRVEITGPTDRKTTVNALN
SGARVWLADLEDATSPTWANVVGGHHSLLDAIRGRADFTSADGKEYRVGPTTPTIVFRPR
GWHLPEKHLEYVDRGGQRCGASASLVDAGLYLFHNAQALVDAGRGPYLYLPKIESHLEAR
LWDEVFRFTEAYLGLRHGTIRATVLIETITAAFEMEEILYELRDHCAGLNAGRWDYIFSV
IKTFRSRGRRWVLPDRSRVTMTVPFMRAYADLLVATCHRRGAQAIGGMSAFVPNRRDPEA
NQRAFAQVRADKQREAEQGFDGTWVAHPDLVPVAREVFDAALGTRVDQRERLREDVVVTA
ADLLDVASAGGAEPGAVTDAGLRTNLSVAVRYLEAWLRGTGAVAIDGLMEDAATAEISRS
QVWQWVHHGVTTDSGATVDADHVRAVLADVLGDLPRSAQDRFDDAAALVTEVALGDEFPT
FLTVPAYAQHLVTRG
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtcctgacgcccgctcccgggctcacgcccagcaccggaccgttcgcccagccg
ttcctcgacatggtcggaccggcggtccccggcaccgacgaggtcctcacgcccgaggcg
ctcgacttcgtcaccgacctgcacacgctgttcggcgcgcgccgcacgaccctgctgcgc
gagcgtcagctgcgccgcgaccgcatcgcgaacggcacggaccccggcttcctgccgctg
accgccgggatccgtgccgaccggacctggcgcgtggccggcccggggcccgggctggag
gaccgtcgggtcgagatcaccggcccgaccgaccgcaagacgaccgtcaacgcgctcaac
tcgggtgcccgcgtgtggctcgcggacctggaggacgcgacgagcccgacctgggcgaac
gtcgtcggcgggcatcacagcctgctcgacgcgatccggggccgcgcggacttcacgtcg
gcggacggcaaggagtaccgcgtcggcccgacgacgccgacgatcgtgttccgcccgcgc
ggctggcacctgcccgagaagcacctggagtacgtcgaccggggcggccagcgctgcggc
gcgtcggcgtccctcgtcgacgcgggcctctacctgttccacaacgcccaggcgctggtc
gacgcgggccgcggcccgtacctgtacctgccgaagatcgagagccacctcgaggcgcgg
ctgtgggacgaggtgttccgcttcaccgaggcgtacctgggcctgcggcacggcacgatc
cgcgcgacggtcctcatcgagacgatcacggccgcgttcgagatggaggagatcctctac
gagctgcgcgaccactgcgcagggctcaacgcgggccgctgggactacatcttcagcgtc
atcaagacgttccgctcgcgcgggcgccgctgggtgctgccggaccgctcgcgcgtgacg
atgaccgtcccgttcatgcgggcctacgcggacctgctcgtcgcgacctgccaccgccgc
ggcgcgcaggcgatcggcggcatgagcgcgttcgtgccgaaccggcgcgatcccgaggcg
aaccagcgcgcgttcgcccaggtgcgggcggacaagcagcgcgaggcggagcagggcttc
gacggcacgtgggtcgcgcacccggacctcgtgcccgtcgcgcgggaggtcttcgacgcg
gcgctcgggacccgggtcgaccagcgcgagcggctgcgcgaggacgtcgtcgtcacggcg
gccgacctgctcgacgtggcctcggcgggcggcgccgagcccggcgcggtgacggacgcg
ggcctgcgcaccaacctctcggtcgccgtccgctacctcgaggcgtggctgcgcgggacc
ggagcggtcgcgatcgacgggctcatggaggacgccgcgacggccgagatctcacgctcg
caggtgtggcagtgggtgcaccacggcgtcacgacggactcgggcgcgacggtcgacgcg
gaccacgtgagggccgtgctcgcggacgtcctgggcgacctgccgcggtcggcgcaggac
cggttcgacgacgccgcggcgctcgtcacggaggtcgcgctcggcgacgagttccccacc
ttcctcacggtgccggcgtacgcccagcacctcgtcacccgcggctga

DBGET integrated database retrieval system