KEGG   Cellulomonas fimi: Celf_2831Help
Entry
Celf_2831         CDS       T01490                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
cfi  Cellulomonas fimi
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celf_2831
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Celf_2831
   00630 Glyoxylate and dicarboxylate metabolism
    Celf_2831
Enzymes [BR:cfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Celf_2831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3158955..3160622
Genome map
AA seq 555 aa AA seqDB search
MTVLTPAPGLTPSTGPFAQPFLDMVGPAVPGTDEVLTPEALDFVTDLHTLFGARRTTLLR
ERQLRRDRIANGTDPGFLPLTAGIRADRTWRVAGPGPGLEDRRVEITGPTDRKTTVNALN
SGARVWLADLEDATSPTWANVVGGHHSLLDAIRGRADFTSADGKEYRVGPTTPTIVFRPR
GWHLPEKHLEYVDRGGQRCGASASLVDAGLYLFHNAQALVDAGRGPYLYLPKIESHLEAR
LWDEVFRFTEAYLGLRHGTIRATVLIETITAAFEMEEILYELRDHCAGLNAGRWDYIFSV
IKTFRSRGRRWVLPDRSRVTMTVPFMRAYADLLVATCHRRGAQAIGGMSAFVPNRRDPEA
NQRAFAQVRADKQREAEQGFDGTWVAHPDLVPVAREVFDAALGTRVDQRERLREDVVVTA
ADLLDVASAGGAEPGAVTDAGLRTNLSVAVRYLEAWLRGTGAVAIDGLMEDAATAEISRS
QVWQWVHHGVTTDSGATVDADHVRAVLADVLGDLPRSAQDRFDDAAALVTEVALGDEFPT
FLTVPAYAQHLVTRG
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtcctgacgcccgctcccgggctcacgcccagcaccggaccgttcgcccagccg
ttcctcgacatggtcggaccggcggtccccggcaccgacgaggtcctcacgcccgaggcg
ctcgacttcgtcaccgacctgcacacgctgttcggcgcgcgccgcacgaccctgctgcgc
gagcgtcagctgcgccgcgaccgcatcgcgaacggcacggaccccggcttcctgccgctg
accgccgggatccgtgccgaccggacctggcgcgtggccggcccggggcccgggctggag
gaccgtcgggtcgagatcaccggcccgaccgaccgcaagacgaccgtcaacgcgctcaac
tcgggtgcccgcgtgtggctcgcggacctggaggacgcgacgagcccgacctgggcgaac
gtcgtcggcgggcatcacagcctgctcgacgcgatccggggccgcgcggacttcacgtcg
gcggacggcaaggagtaccgcgtcggcccgacgacgccgacgatcgtgttccgcccgcgc
ggctggcacctgcccgagaagcacctggagtacgtcgaccggggcggccagcgctgcggc
gcgtcggcgtccctcgtcgacgcgggcctctacctgttccacaacgcccaggcgctggtc
gacgcgggccgcggcccgtacctgtacctgccgaagatcgagagccacctcgaggcgcgg
ctgtgggacgaggtgttccgcttcaccgaggcgtacctgggcctgcggcacggcacgatc
cgcgcgacggtcctcatcgagacgatcacggccgcgttcgagatggaggagatcctctac
gagctgcgcgaccactgcgcagggctcaacgcgggccgctgggactacatcttcagcgtc
atcaagacgttccgctcgcgcgggcgccgctgggtgctgccggaccgctcgcgcgtgacg
atgaccgtcccgttcatgcgggcctacgcggacctgctcgtcgcgacctgccaccgccgc
ggcgcgcaggcgatcggcggcatgagcgcgttcgtgccgaaccggcgcgatcccgaggcg
aaccagcgcgcgttcgcccaggtgcgggcggacaagcagcgcgaggcggagcagggcttc
gacggcacgtgggtcgcgcacccggacctcgtgcccgtcgcgcgggaggtcttcgacgcg
gcgctcgggacccgggtcgaccagcgcgagcggctgcgcgaggacgtcgtcgtcacggcg
gccgacctgctcgacgtggcctcggcgggcggcgccgagcccggcgcggtgacggacgcg
ggcctgcgcaccaacctctcggtcgccgtccgctacctcgaggcgtggctgcgcgggacc
ggagcggtcgcgatcgacgggctcatggaggacgccgcgacggccgagatctcacgctcg
caggtgtggcagtgggtgcaccacggcgtcacgacggactcgggcgcgacggtcgacgcg
gaccacgtgagggccgtgctcgcggacgtcctgggcgacctgccgcggtcggcgcaggac
cggttcgacgacgccgcggcgctcgtcacggaggtcgcgctcggcgacgagttccccacc
ttcctcacggtgccggcgtacgcccagcacctcgtcacccgcggctga

DBGET integrated database retrieval system