KEGG   Cellulomonas fimi: Celf_2832Help
Entry
Celf_2832         CDS       T01490                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cfi  Cellulomonas fimi
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Celf_2832
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celf_2832
   00620 Pyruvate metabolism
    Celf_2832
   00650 Butanoate metabolism
    Celf_2832
  Lipid metabolism
   00071 Fatty acid degradation
    Celf_2832
  Amino acid metabolism
   00350 Tyrosine metabolism
    Celf_2832
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Celf_2832
   00626 Naphthalene degradation
    Celf_2832
Enzymes [BR:cfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Celf_2832
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Celf_2832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3160926..3163676
Genome map
AA seq 916 aa AA seqDB search
MTATESSTTRTTKAKKPVATAPTAPAAPATPVSEDQVATAIDALVANATKALAEYARFTQ
EDVDRFVKKGSVAALDQHGQLAKLAVEETGRGVFEDKAVKNIFACEHVTNSMADLKTVGV
IARDDLRGITEIAEPVGVICGVTPVTNPTSTAIFKSLIALKTRNPIIFAFHPNAQASSVA
AAKIVRDAAVAAGAPEHCIQWVETPSIAATNMLMNHPGVALILATGGNAMVRAAYSCGKP
ALGVGAGNVPAYIEKTAKLKRAVNDVVLSKAFDNGMICASEQAVILDDEIYDAAMAEFKV
LHAYLASPAEKAMLEQFIFGVDAQGTNCADAKLNPTVVGKSPQWIAEQSGFSVPADTSII
LAEVDGVGPHEPLTREKLAPVLAVLRATTTEQGISLAEQMVEFDGLGHSAAIHTRNDALT
EEFGSRVKAVRVIANAPSSLGGIGDIYNSFIPSLTLGCGSYGRNSVSNNVSAVNLINVKR
VGRRNNNLQWFKVPAKTYFEPNAIRYLQDMADVERVTIVTDATMTTLGFVDKIIDVLNRR
PGKVALQIIDQVEPEPSVRTVQNGAAQMRHFRPDTIIALGGGSPMDAAKVMWLLYEHPEI
VFSDLKQKFFDVRKRAFKFPTLGELAKLVCIPTTSGTGAEVTPFAVISDPDAGKKYPLAD
YALTPTVAIIDPVLTAKMPPSLAADSGFDALTHATEAFVSVYANDFTDGMALQAIRLIFD
NLAMSVNGDPADPATRDAREKMHNAGTIAGMSFGNAFLGIVHAMAHVIGSTHHLVHGRTN
ATLLPHVIRYNGTVPTKLTSWPKYESYVAPERFQQIAQMLGLPAATPAEGVESYALAVEA
LRAKVGIPASFQAQGVSEQDFMGRLDEVAMGAYEDQCAPANPRMPMIDDMKDLMTAAFYG
TSLEDVRTRRTEQQEG
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccaccgagtccagcacgacccgcacgaccaaggccaagaagcctgtcgcgacc
gcgccgacggcgccggccgcccccgccacgcccgtctccgaggaccaggtcgcgaccgcg
atcgacgcgctcgtcgccaacgcgaccaaggcgctcgccgagtacgcgcggttcacccag
gaggacgtcgaccggttcgtcaagaagggctccgtcgcggcgctcgaccagcacggccag
ctcgcgaagctcgccgtcgaggagaccggccgcggcgtcttcgaggacaaggccgtgaag
aacatcttcgcgtgcgagcacgtcacgaactcgatggcggacctcaagaccgtcggcgtg
atcgcccgcgacgacctgcgcggcatcacggagatcgccgagcccgtcggcgtcatctgt
ggcgtcaccccggtgacgaacccgacctcgacggcgatcttcaagtcgctcatcgcgctg
aagacccgcaacccgatcatcttcgcgttccacccgaacgcgcaggcgtcctcggtcgcc
gcggccaagatcgtccgcgacgcggccgtcgccgccggtgccccggagcactgcatccag
tgggtcgagacgccgtccatcgcggcgacgaacatgctgatgaaccacccgggcgtcgcg
ctcatcctcgcgaccggtggcaacgcgatggtccgcgccgcgtactcgtgcggcaagccg
gccctcggcgtcggcgcgggcaacgtccccgcctacatcgagaagaccgccaagctcaag
cgcgccgtgaacgacgtggtgctctcgaaggcgttcgacaacggcatgatctgcgcctcg
gagcaggccgtcatcctcgacgacgagatctacgacgccgccatggcggagttcaaggtc
ctgcacgcctacctggcgagcccggccgagaaggcgatgctcgagcagttcatcttcggt
gtcgacgcgcagggcaccaactgcgccgacgcgaagctcaacccgaccgtcgtcggcaag
tcgccgcagtggatcgccgagcagtccggcttctcggtccccgcggacacctcgatcatc
ctggccgaggtcgacggcgtcggcccgcacgagccgctgacccgcgagaagctcgcgccg
gtcctcgcggtgctgcgcgcgacgacgacggagcagggcatctccctggccgagcagatg
gtggagttcgacggcctgggccactcggccgcgatccacacccgcaacgacgccctcacc
gaggagttcggcagccgggtcaaggccgtccgcgtcatcgccaacgccccgtcctcgctg
ggcggcatcggcgacatctacaactccttcatcccctcgctcacgctgggctgcggctcc
tacggccgcaactcggtctccaacaacgtctcggcggtgaacctcatcaacgtgaagcgc
gtcggccgccgcaacaacaacctgcagtggttcaaggtccccgcgaagacctacttcgag
ccgaacgcgatccgctacctgcaggacatggccgacgtcgagcgcgtcacgatcgtcacc
gacgcgacgatgacgaccctgggcttcgtcgacaagatcatcgacgtcctcaaccgccgc
cccggcaaggtcgcgctgcagatcatcgaccaggtcgagccggagccgtccgtccgcacc
gtgcagaacggcgcggcgcagatgcgtcacttccgtcccgacacgatcatcgccctcggc
ggtggctcgccgatggacgccgcgaaggtcatgtggctgctgtacgagcacccggagatc
gtcttctccgacctcaagcagaagttcttcgacgtccgcaagcgtgcgttcaagttcccg
acgctgggtgagctcgcgaagctcgtctgcatcccgacgacgtcgggcacgggcgccgag
gtcacgccgttcgcggtcatctcggaccccgacgccggcaagaagtacccgctggcggac
tacgcgctgaccccgacggtcgcgatcatcgacccggtgctcaccgcgaagatgcccccg
tcgctcgcggcggactcgggcttcgacgccctcacgcacgccaccgaggcgttcgtgtcg
gtctacgcgaacgacttcaccgacggcatggcgctgcaggcgatccgcctgatcttcgac
aacctcgcgatgtcggtgaacggcgacccggccgacccggccacgcgggacgcgcgggag
aagatgcacaacgccggcacgatcgcgggcatgagcttcggcaacgcgttcctcgggatc
gtgcacgccatggcgcacgtcatcggctcgacgcaccacctggtgcacggccggacgaac
gcgacgctcctgccgcacgtgatccgctacaacggcacggtcccgaccaagctcacgagc
tggccgaagtacgagagctacgtcgcccccgagcggttccagcagatcgcgcagatgctc
ggcctgcccgccgccaccccggccgagggcgtcgagtcctacgcgctggccgtcgaggcc
ctgcgggccaaggtcgggatcccggcgtcgttccaggcgcagggcgtgtccgagcaggac
ttcatgggtcgcctcgacgaggtcgccatgggtgcctacgaggaccagtgcgctcccgcc
aacccgcggatgccgatgatcgacgacatgaaggacctcatgaccgcggccttctacggc
acgtcgctggaggacgtccgtacccgccgcaccgagcagcaggagggctga

DBGET integrated database retrieval system