KEGG   Cellulomonas fimi: Celf_2869Help
Entry
Celf_2869         CDS       T01490                                 

Definition
succinate dehydrogenase hydrophobic anchor subunit-like protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
cfi  Cellulomonas fimi
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celf_2869
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celf_2869
   00650 Butanoate metabolism
    Celf_2869
  Energy metabolism
   00190 Oxidative phosphorylation
    Celf_2869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3205088..3205546
Genome map
AA seq 152 aa AA seqDB search
MSLVADPKAPRPPKAGPGRRTTRGNTELYGWVFMRASGVLLVVLIFGHLFVNLVAGEGVT
AIDFGFVAGKWASPFWQVWDLLMLWLAMIHGTNGMRTIVNDYAEKDTTRLVLKGLLYLAF
VLVVVLGTLVIFTFDPCPTGSPADLLPSFCTA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggtcgccgaccccaaggcaccgcgtccccccaaggcgggcccgggccgccgc
acgacgcgcggcaacaccgagctctacggctgggtcttcatgcgcgcgtcgggcgtcctg
ctcgtcgtgctgatcttcgggcacctgttcgtcaacctggtcgccggcgagggcgtcacg
gcgatcgacttcgggttcgtcgccggcaagtgggcgtcgccgttctggcaggtctgggac
ctgctcatgctctggctcgcgatgatccacggcaccaacggcatgcgcacgatcgtcaac
gactacgccgagaaggacaccacgcggctggtcctcaagggcctgctctacctcgcgttc
gtcctggtggtcgtgctcggcacgctcgtgatcttcacgttcgacccctgccccacgggc
agcccggccgacctcctcccctcgttctgcacggcctga

DBGET integrated database retrieval system