KEGG   Cellulomonas fimi: Celf_2917Help
Entry
Celf_2917         CDS       T01490                                 

Definition
hydroxymethylbutenyl pyrophosphate reductase (EC:1.17.1.2)
Orthology
K03527  
4-hydroxy-3-methylbut-2-enyl diphosphate reductase [EC:1.17.1.2]
Organism
cfi  Cellulomonas fimi
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cfi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3257599..3258642)
Genome map
AA seq 347 aa AA seqDB search
MTSATDQAPGVPSTKRVLLAAPRGYCAGVDRAVVAVEKALEHYGAPVYVRKEIVHNKYVV
ETLSARGAVFVDETDEVPEGARVVFSAHGVSPAVRAAATARSLQTIDATCPLVTKVHKEA
VRFAADDFDILLIGHDGHEEVEGTQGEAPEHIQVVNSPDAVDGVEVRDPARVVWISQTTL
SVDETMETVRRLREKFPLLQDPPSDDICYATQNRQVAVKKLAPHCDVVITVGSANSSNSV
RLVEVALDAGARASYRVDKAAEIDPAWLEGATTVGVTSGASVPEILVRDVLELLAQHGFG
DVEEVRTATEDLMFSLPRELRADLKASGATPDRPRREDRRSLDVQPA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgacctctgcgaccgaccaggcccccggcgtgccgtcgaccaagcgcgtgctgctcgcg
gcaccgcgcgggtactgcgccggcgtcgaccgggccgtcgtcgccgtcgagaaggccctc
gagcactacggcgcgcccgtgtacgtccgcaaggagatcgtgcacaacaagtacgtcgtc
gagacgctgtccgcccgtggcgcggtgttcgtcgacgagaccgacgaggtgcccgagggt
gcgcgcgtcgtgttctccgcgcacggcgtctcgcccgcggtccgtgccgcggcgaccgcg
cggtcgctgcagacgatcgacgcgacgtgccccctggtcacgaaggtgcacaaggaggcc
gtgcggttcgccgccgacgacttcgacatcctgctcatcggccacgacggtcacgaggag
gtcgagggcacgcagggcgaggcgcccgagcacatccaggtcgtcaactccccggacgcc
gtcgacggggtcgaggtgcgcgaccccgcgcgggtcgtgtggatctcgcagaccacgctg
tcggtcgacgagaccatggagaccgtccgccgcctgcgcgagaagttcccgctgctgcag
gacccgcccagcgacgacatctgctacgcgacgcagaaccgccaggtcgcggtcaagaag
ctcgcgccgcactgcgacgtcgtcatcaccgtgggctccgcgaactcgtccaactcggtg
cggctcgtcgaggtcgccctcgatgccggggcgcgtgcgtcctaccgcgtcgacaaggct
gccgagatcgaccccgcctggctcgagggggccacgacggtgggcgtgacctccggcgcg
tccgtgccggagatcctggtccgcgacgtcctcgagctgctcgcgcagcacggcttcggc
gacgtcgaggaggtccgcaccgcgaccgaggacctcatgttctccctgccgcgcgagctc
cgcgccgacctcaaggcctcgggcgccacgcccgaccgcccccgccgcgaggaccgccgc
tccctggacgtccagcccgcctga

DBGET integrated database retrieval system