KEGG   Cellulomonas fimi: Celf_3076Help
Entry
Celf_3076         CDS       T01490                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cfi  Cellulomonas fimi
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Celf_3076
Enzymes [BR:cfi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Celf_3076
    3.5.1.-  
     Celf_3076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3447787..3448377
Genome map
AA seq 196 aa AA seqDB search
MSTAEPTRRALVVVDVQPTFCEGGALPVEGGNAVARDIALYVAEHRDRYDMVVTTQDWHI
EPGDHFSTTPDFVDTWPPHGVAGTAEADLHPALSAIVPEASVKKGQYAAAYSGFEGVDGE
GRGLAEILRDGGITDVDVVGLAESHCVRSTAVDAVGLGLRTRVLTDLTAPVTPELGAAAR
EEMRAAGAELVASTDL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgcggaaccgacccgtcgggccctcgtcgtcgtcgacgtgcagccgaccttc
tgcgagggcggcgcgctgcccgtcgagggcgggaacgccgtcgcccgtgacatcgcgctg
tacgtcgcggagcaccgagaccgctacgacatggtcgtcacgacgcaggactggcacatc
gagccgggcgaccacttctccacgacccccgacttcgtcgacacgtggccgccgcacggc
gtcgccggcaccgcggaggccgacctgcacccggcgctgtccgcgatcgtgcccgaggcg
agcgtgaagaagggccagtacgcggccgcgtactcgggcttcgagggggtcgacggcgag
ggccgcgggctcgcggagatcctgcgcgacggcggcatcacggacgtcgacgtcgtgggg
ctcgcggagtcgcactgcgtgcggtcgacggcggtcgacgccgtggggctgggcctgcgc
acgcgtgtgctgaccgacctgaccgcgccggtgacgcccgagctcggggctgcggcgcgc
gaggagatgcgggccgcgggcgccgagctggtggcgtcgacggacctctga

DBGET integrated database retrieval system