KEGG   Cellulomonas fimi: Celf_3271Help
Entry
Celf_3271         CDS       T01490                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cfi  Cellulomonas fimi
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cfi00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3656789..3658885)
Genome map
AA seq 698 aa AA seqDB search
MTSRTTEQVRRQARRQVRYGGDYNPEQWPRDVWEDDHRAFDLAGVTTLTVGVFAWAHLQP
EEGRYDFTTLDAIVERAAASGRDVVLATPSGAMPPWLARAYPDACRVDVEGRRHVYGQRH
NHCPSSPDFRRLSVALASRLAERYAGHPAVVAWHVGNEYGGACYCGLCADAFRGWLRHRY
GTLDRLNDAWNATFWSHTYTDWAQVQPPTMLSEHWRGPNHTAFQGTTLDYRRFMSDALLG
GFVAEKTAIRAHDATTPVTTNFMGLYQPVDYHRWAEHLDLVTWDNYPPADTPLRTAARMA
ATHAAMRGLRGGEPFWVMEQTPSTTASRDVNPVKRPGVLALWTWQSVAHGADATLYFQLR
QSRGACEKYHGAVLDHSGRTDTRVFREVAALGADLARLGDGVLGARTPARVALLLDWDSW
WAVEMTDGYNRHVSYVQTLLQYHRALWAANAAVDVVPVTADLSGYDVVVAPVLHVLAGDV
VERLTAFVHRGGSLVTTFYGGRVDEDTNAFLGEPPLDTLLGVRVEETDSAPPGAANPVTL
RLGGAGTDGTPVDWDGTTTHPATLVFELLVPHDGTDVVGTYGADFYAGTPAVTRAARGEG
AAWHVGTALDDDGVARVLGHVLDQHGLMGPHADEPALEVVDRVHPDGTRYRFVLHHGSQP
LTVTSEVAGTDVLSGRVVRRDDTLTLAPAGVLVLKETP
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcccgcaccaccgagcaggtccgcaggcaggcccgtcggcaggtccgctacggc
ggcgactacaacccggagcagtggccgcgcgacgtgtgggaggacgaccaccgggccttc
gacctcgcgggcgtcacgaccctcacggtgggcgtgttcgcgtgggcgcacctgcagccg
gaggagggccggtacgacttcacgacgctcgacgcgatcgtcgagagggccgccgcctcc
ggccgggacgtggtgctcgcgacaccgtcgggcgcgatgccgccctggctcgcgcgcgcc
taccccgacgcgtgccgcgtcgacgtcgaggggcggcggcacgtgtacgggcagcggcac
aaccactgcccgtcgtcgccggacttccgccggctgtccgtcgcgctggcgtcgcgcctc
gcggagcggtacgcgggccacccggccgtcgtcgcctggcacgtcggcaacgagtacggc
ggcgcctgctactgcggcctgtgcgcggacgcgttccgcggctggctgcggcaccggtac
ggcacgctcgaccgcctcaacgacgcatggaacgcgacgttctggtcccacacctacacg
gactgggcgcaggtccagccgccgacgatgctgtccgagcactggcgcggcccgaaccac
accgcgttccagggcacgacgctcgactaccggcggttcatgtccgacgcgctgctcggc
gggttcgtcgccgagaagacggcgatccgcgcgcacgacgccacgacccccgtgacgacg
aacttcatgggcctgtaccagccggtcgactaccaccgctgggccgagcacctcgacctc
gtcacgtgggacaactacccgcccgccgacaccccgctgcgcaccgccgcccgcatggcc
gcgacgcacgccgcgatgcgtggcctgcgcggcggcgagccgttctgggtcatggagcag
acaccgtcgacgaccgcgtcgcgcgacgtgaaccccgtcaagcggccgggagtcctcgcg
ctgtggacgtggcagtccgtcgcgcacggtgcggacgcgacgctctacttccagctgcgg
cagtcgcggggtgcctgcgagaagtaccacggcgcggtcctcgaccactcgggccgcacc
gacacgcgcgtgttccgcgaggtcgcggcactcggcgccgacctggcccggctcggcgac
ggcgtgctcggcgcgcgcaccccggcccgcgtcgcgctgctgctcgactgggactcgtgg
tgggccgtcgagatgaccgacggctacaaccggcacgtctcctacgtgcagacgctcctg
cagtaccaccgggcgctgtgggcggcgaacgccgcggtcgacgtcgtgcccgtgaccgcc
gacctgtccgggtacgacgtcgtcgtcgcgcccgtgctgcacgtcctcgcgggtgacgtc
gtcgagcggctgaccgcgttcgtgcaccgcggcgggtcgctcgtcacgaccttctacggc
gggcgcgtcgacgaggacaccaacgccttcctcggcgagccgccgctcgacaccctgctc
ggggtgcgcgtcgaggagaccgactccgcgccgccgggcgctgccaaccccgtcacgctg
cgcctcggaggcgccggcaccgacggcacgcctgtcgactgggacggcaccacgacccac
cccgcgacgctcgtcttcgaactcctcgtcccgcacgacggcaccgacgtcgtcggcacg
tacggcgccgacttctacgccggcacgcccgccgtgacgcgcgcggcccgtggcgagggt
gcggcgtggcacgtcgggaccgcgctcgacgacgacggggtcgcacgcgtgctggggcac
gtgctcgaccagcacgggctcatgggcccgcacgccgacgagcccgcgctcgaggtcgtc
gaccgcgtgcaccccgacggcacccggtaccggttcgtgctgcaccacgggtcgcagccc
ctgaccgtgacctccgaggtggcgggcaccgacgtgctcagcgggcgcgtcgtccgccgc
gacgacacgctgacactggcacccgccggcgtcctcgtcctcaaggagaccccgtga

DBGET integrated database retrieval system